KEGG   Bacillus subtilis subsp. subtilis 168: BSU09530
Entry
BSU09530          CDS       T00010                                 

Symbol
yhdN
Name
(RefSeq) general stress protein 69
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 939270
NCBI-ProteinID: NP_388834
Pasteur: BG13020
BSORF: BG13020
UniProt: P80874 A0A6M3Z9F7
Structure
PDB: 
1PZ1

Position
1030265..1031260
AA seq 331 aa
MEYTSIADTGIEASRIGLGTWAIGGTMWGGTDEKTSIETIRAALDQGITLIDTAPAYGFG
QSEEIVGKAIKEYGKRDQVILATKTALDWKNNQLFRHANRARIVEEVENSLKRLQTDYID
LYQVHWPDPLVPIEETAEVMKELYDAGKIRAIGVSNFSIEQMDTFRAVAPLHTIQPPYNL
FEREMEESVLPYAKDNKITTLLYGSLCRGLLTGKMTEEYTFEGDDLRNHDPKFQKPRFKE
YLSAVNQLDKLAKTRYGKSVIHLAVRWILDQPGADIALWGARKPGQLEALSEITGWTLNS
EDQKDINTILENTISDPVGPEFMAPPTREEI
NT seq 996 nt   +upstreamnt  +downstreamnt
atggaatataccagtatagcagatacaggaatagaagcctccagaatcggcctcggcaca
tgggccattggcggaacgatgtggggaggcactgacgaaaaaacatcgattgaaacaatc
cgcgccgctcttgatcaggggattacactgattgacaccgcaccggcttacggcttcggg
cagtccgaggaaattgtcggaaaggcaatcaaagagtacggcaaaagagaccaggtgatt
ctcgcaacgaaaacggctctggactggaagaacaaccagctgttccgccatgcgaacaga
gcgagaattgtagaggaagttgagaattctttgaagcggcttcaaacagactatattgat
ctttatcaggtgcattggcccgatccgcttgtgccaattgaagaaacggctgaagtcatg
aaggaattatatgatgcgggaaaaatccgggcgattggcgtcagcaatttttcaattgag
caaatggatacatttcgcgccgtcgcacctctccatacgattcagcctccatataatctg
tttgaaagagagatggaagagagtgtccttccttatgcgaaagataacaagataacaaca
ttattatacggcagtttatgcagagggctgttaacaggcaaaatgactgaagaatataca
tttgagggcgatgatctgcgtaatcacgatccaaaattccagaagccccgctttaaagag
tatctttctgctgtgaatcaattggataagctggcgaagacacgttatggaaaatcagtg
attcacttggctgtcagatggatcttagatcagccgggagcggatatcgctctttgggga
gcaagaaagcctgggcagcttgaggccctatctgagattacaggctggacgctgaacagt
gaagatcagaaagatatcaatactatattggaaaatacgatatcagaccctgtcggaccg
gagtttatggccccgccgaccagagaggaaatataa

DBGET integrated database retrieval system