KEGG   Bacillus subtilis subsp. subtilis 168: BSU09540
Entry
BSU09540          CDS       T00010                                 

Symbol
plsC
Name
(RefSeq) 1-acyl-sn-glycerol-3-phosphate acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU09540 (plsC)
   00564 Glycerophospholipid metabolism
    BSU09540 (plsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU09540 (plsC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     BSU09540 (plsC)
Lipid biosynthesis proteins [BR:bsu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   BSU09540 (plsC)
SSDB
Motif
Pfam: Acyltransferase MYRF_ICA MbeB_N
Other DBs
NCBI-GeneID: 936269
NCBI-ProteinID: NP_388835
Pasteur: BG13021
BSORF: BG13021
UniProt: O07584 A0A6M3Z9E0
Position
1031395..1031994
AA seq 199 aa
MYKFCANALKVILSLRGGVKVYNKENLPADSGFVIACTHSGWVDVITLGVGILPYQIHYM
AKKELFQNKWIGSFLKKIHAFPVDRENPGPSSIKTPIKLLKEGEIVGIFPSGTRTSEDVP
LKRGAVTIAQMGKAPLVPAAYQGPSSGKELFKKGKMKLIIGEPLHQADFAHLPSKERLAA
MTEALNQRIKELENKLDQL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtataagttttgtgcaaatgctttaaaagttattctttctcttcgcggaggagtgaag
gtgtataacaaagaaaaccttccggccgattcaggttttgtcatcgcgtgtacacattcc
ggctgggttgatgtgattacactcggagtcgggattcttccttatcaaatacactacatg
gcgaaaaaagagctttttcaaaataaatggatcggttcgtttctgaagaaaattcatgcc
tttccggtagatcgggaaaatcccgggccaagcagtattaaaacgccgattaagctgctg
aaagaaggagagatcgtcggtatcttcccaagcggaacaagaacctctgaggatgtgcct
ttgaaaagaggtgcggtgacgattgcgcaaatggggaaagcgccgcttgtccccgctgca
tatcagggcccttcaagcggaaaagaattattcaaaaaaggaaaaatgaagctgattatc
ggtgagcctcttcaccaggctgattttgcccacctgccttcaaaggaaagacttgcagca
atgacagaggctttgaatcagcggattaaagaactagagaataaacttgatcagctataa

DBGET integrated database retrieval system