KEGG   Bacillus subtilis subsp. subtilis 168: BSU09550
Entry
BSU09550          CDS       T00010                                 

Symbol
yhdP
Name
(RefSeq) hypothetical protein
  KO
K03699  magnesium and cobalt exporter, CNNM family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09550 (yhdP)
   02042 Bacterial toxins [BR:bsu02042]
    BSU09550 (yhdP)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU09550 (yhdP)
Bacterial toxins [BR:bsu02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   BSU09550 (yhdP)
SSDB
Motif
Pfam: CNNM CorC_HlyC CBS
Other DBs
NCBI-GeneID: 939280
NCBI-ProteinID: NP_388836
Pasteur: BG13022
BSORF: BG13022
UniProt: O07585 A0A6M4JLI3
Position
complement(1032063..1033397)
AA seq 444 aa
MDIVNLILVAVLIALTAFFVASEFAIIRIRGSRIDQLIAEGNKAAIAVKKVTTHLDEYLS
ACQLGITLTSIGLGVLGESTIERLLHPLFVQMNVPGSLSHVISFIFAYAIITFLHVVVGE
LAPKTVAIQKAEAVSMLFAKPLIWFYRIAFPFIWLLNNSARLLTKAFGLETVSENELAHS
EEELRIILSESYKSGEINQSEFKYVNKIFEFDDRLAKEIMIPRTEIVSLPHDIKISEMMD
IIQIEKYTRYPVEEGDKDNIIGVINIKEVLTACISGEVSVDSTISQFVNPIIHVIESAPI
QDLLVKMQKERVHMAILSDEYGGTAGLVTVEDIIEEIVGEIRDEFDIDEISEIRKIGEGH
YILDGKVLIDQVNDLLGIHLENEEVDTIGGWFLTQKYDVEKDDSIIEEGCEFIINEIDGH
HVAYIEVKKLQEEELLETANQQEA
NT seq 1335 nt   +upstreamnt  +downstreamnt
ttggacatagtgaatttgattttagttgctgttttaatcgccctgacggcatttttcgtg
gcatctgagtttgccattatcagaatcagaggctcacggatcgatcagctgatcgcggaa
ggaaataaagcagcaatagccgtaaaaaaagtgaccacgcatcttgatgaatatttatct
gcgtgtcagctcggaattacattgacttccatcggattaggggttttaggtgaatcaacg
atcgaaaggctgcttcacccgcttttcgtccaaatgaacgttccaggttccctttcacat
gtcatatcgtttatttttgcgtatgccattatcacgttcttacacgttgttgtcggagaa
cttgcacctaaaacagtcgctatccaaaaggcggaagcagtgtctatgctgtttgcgaaa
ccgctgatttggttttaccgcatcgcgttcccattcatttggcttttgaacaattccgca
cggttattgaccaaagcatttggcctggagaccgtttcagaaaacgaactggctcactca
gaagaagagctgcgaatcattttgtctgaaagctataaaagcggtgaaatcaaccaatca
gagtttaaatatgtgaataaaatctttgaatttgacgacaggctcgcgaaagaaattatg
attccgcggaccgaaattgtcagccttccgcatgatatcaagatttctgaaatgatggac
atcattcagattgaaaaatatacccgctaccctgtggaagagggcgataaagataacatt
atcggggttattaacattaaagaagtgctgaccgcctgcatcagcggtgaggtatctgtt
gattccaccatttctcaattcgtcaaccctatcattcatgtcattgaatctgcgccgatc
caagacctgcttgtcaaaatgcaaaaagagagggtccacatggccattttgtctgatgaa
tacggcggtactgccgggcttgtgacggttgaggacatcattgaggaaattgtcggtgaa
atccgcgacgaatttgatattgatgaaattagcgaaatccgcaaaatcggcgaaggccat
tatattcttgacggaaaagtgttaattgaccaagtaaacgacctgctaggcatccattta
gagaacgaagaagtcgatacaatcggcggctggttccttactcaaaaatacgatgttgaa
aaagatgattccatcatcgaagagggctgcgaattcatcattaatgaaattgacggccac
cacgtcgcatatattgaagtgaaaaagcttcaagaagaagaacttctggagacagctaac
cagcaggaagcataa

DBGET integrated database retrieval system