KEGG   Bacillus subtilis subsp. subtilis 168: BSU09590
Entry
BSU09590          CDS       T00010                                 

Symbol
yhdT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF21 CorC_HlyC CBS
Other DBs
NCBI-GeneID: 936275
NCBI-ProteinID: NP_388840
Pasteur: BG13026
BSORF: BG13026
UniProt: O07589 A0A6M3Z8Y4
Position
1035554..1036939
AA seq 461 aa
MDDIDSLILIGVLIALTAFFVASEFAIVRVRRSRIDQLITEGNKRAILARRVITDLDEYL
SASQLGITLTSIGLGVLGEPAFERLLHPLFEPLGLPDSVSHAVSFAVAYGLITFLHVVVG
ELAPKTVAIQKAEQLTLLIAGPLRLFYLLLFPFIWILNGSARLLCGMFGLKPASEHDGSH
SEEELRMLLSESLKNGEINPSEYKYVNKIFEFDNRIAKEIMIPRKEMAAVSTEMTMAEML
EVMLKEKYTRWPVTDGDKDSVLGLVNTKHLFSDLLFMTEEERMKMTIHPYVRPVIEVIET
IPVHDLLIKMQRERIHMAILSDEYGGTSGLVTTEDILEEIVGEIRDEFDEDEQPLIQKLG
DGHYVMDGKVRIDQVNSLLGASIQEDVDTIGGLILKENIDIEAGESIRIGSYTIKVLKMD
GRLIKQIDIKEEAGNTTGITAHHKLPLPEPVMLNSATLSEK
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggacgatattgacagtctgattttaattggcgtgctcattgctttaaccgcgtttttc
gttgcaagcgagtttgcgattgttagagtgaggagatccagaatagatcagcttatcaca
gaaggaaacaaacgggcgatactcgcaaggcgtgtcattacagatttggatgaatattta
tccgcatcccagctaggcattacattgacatcaatcgggcttggcgtactgggtgagccg
gcctttgaacggctgctgcatccactgtttgaaccgctcggcttgccggactcggtttca
catgcagtctcttttgcagtcgcgtacggcttgatcacgttcctgcacgttgttgtaggt
gaactggccccgaaaacggtcgcgattcaaaaggcagaacagctgactttactgatagcg
ggccctttgcgtttattctatttgctcctgtttccgtttatttggatcctcaatggatcg
gcgcggcttttatgcgggatgttcggtttgaagcctgcgtcagaacatgatggttcccat
tctgaggaagaactcaggatgctgttatctgagagtttaaaaaacggagagattaatccg
tctgaatataaatatgtgaataagatttttgaatttgataatcggatcgccaaagaaatt
atgataccgcggaaggaaatggctgctgtgtcaactgagatgacgatggccgagatgctt
gaagtcatgctgaaggaaaaatacacgcgctggccagtcacagatggagacaaagacagt
gtgctcggtttggtcaatacgaagcatttgttttctgatttgctgtttatgacagaagaa
gaacgaatgaagatgacgatccatccgtatgtgaggccggtcatcgaagtgattgaaacg
atcccggttcatgacttgctgattaaaatgcagcgcgagcgcattcatatggctatattg
tcggatgaatacggaggaacctcgggacttgtgacgacagaggatattcttgaggaaatt
gtcggagagatccgagatgaatttgatgaagatgaacagccgctgatccaaaagcttggc
gacggccattatgtgatggatggaaaggttcggatcgatcaggtgaacagccttcttggc
gcatcgattcaagaagacgtcgatacgatcggcgggctgatattaaaagaaaacatcgat
attgaggctggtgaatccattcgcatcggttcatatacgataaaggtgctgaagatggac
ggccgattaatcaagcaaatcgatataaaagaagaagccggcaacacaaccgggattacg
gcgcaccacaagctgccgctgcccgagcctgtgatgctgaacagtgcaaccttgagcgag
aaataa

DBGET integrated database retrieval system