KEGG   Bacillus subtilis subsp. subtilis 168: BSU09600Help
Entry
BSU09600          CDS       T00010                                 

Gene name
crcBA
Definition
(RefSeq) camphor resistance protein CrcB
  KO
K06199  fluoride exporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09600 (crcBA)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU09600 (crcBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRCB
Motif
Other DBs
NCBI-GeneID: 939754
NCBI-ProteinID: NP_388841
Pasteur: BG13027
BSORF: BG13027
UniProt: O07590
Position
complement(1036953..1037309)
Genome map
AA seq 118 aa AA seqDB search
MTLAGIFIGGGLGAMLRFWLGNVITAKTKGLSLPIGILTVNILGALGLGIFTGLHVANAS
VSLIIGTGFFGAFTTFSTFSVETIQLLMAKRVKESILYIVLTLCGSLFAFWCGWTITI
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgacactagcgggtattttcatagggggcggacttggcgcaatgcttcgcttctggctt
ggcaatgtcataaccgccaaaaccaaaggtctcagcctgcccattggcatactgacagtc
aatattctcggagctctcgggctcggaatatttacaggacttcacgttgcaaatgcttcg
gtctcgcttatcattggcacggggttttttggcgcctttacgaccttttccacattcagc
gttgaaactattcaactccttatggccaaacgtgtaaaagaaagcatcttgtacatcgtc
ctgacactttgcgggtcgctttttgcattttggtgcggctggacaatcacaatataa

DBGET integrated database retrieval system