KEGG   Bacillus subtilis subsp. subtilis 168: BSU09610
Entry
BSU09610          CDS       T00010                                 

Symbol
yhdV
Name
(RefSeq) chromosome condensation protein CrcB
  KO
K06199  fluoride exporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09610 (yhdV)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU09610 (yhdV)
SSDB
Motif
Pfam: CRCB
Other DBs
NCBI-GeneID: 936272
NCBI-ProteinID: NP_388842
Pasteur: BG13028
BSORF: BG13028
UniProt: O07591 A0A6M3Z8Y7
Position
complement(1037306..1037701)
AA seq 131 aa
MKIYSAVFIGGALGACLRYGLNLWIHTGQFPAATWLENAAGSLLLGILTGFFMIGAKRPL
LSAFLGTGFCGGFTTMSTFSKETVMLLQGQPSLALLYVAASLISGIIFALIGVFVGRRIA
GIQQRKGLQEK
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaaaatatatagcgcggtttttatcggaggcgcgcttggcgcctgcctccgatacgga
ttaaacttatggatacacaccggtcagttcccggcggcaacctggctggaaaatgcggca
ggcagccttctattaggcattttgaccggattttttatgatcggggcaaaacggcctctg
ctgtcggcttttttaggcaccggcttttgcggaggcttcacaacaatgtccacgttttct
aaggaaacagtgatgcttttgcaaggacaaccctcattggctcttttatatgtggcagcc
tcattgatatcagggatcatatttgcactgattggtgtttttgtgggacggcgcatagca
ggcattcagcaaagaaaggggctgcaggaaaaatga

DBGET integrated database retrieval system