KEGG   Bacillus subtilis subsp. subtilis 168: BSU09640Help
Entry
BSU09640          CDS       T00010                                 

Gene name
yhdY
Definition
(RefSeq) small mechanosensitive ion chanel protein MscS
  KO
K16052  MscS family membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09640 (yhdY)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU09640 (yhdY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel
Motif
Other DBs
NCBI-GeneID: 939285
NCBI-ProteinID: NP_388845
Pasteur: BG13031
BSORF: BG13031
UniProt: O07594
Position
1038909..1040024
Genome map
AA seq 371 aa AA seqDB search
MPDYLQQYFTLDNIIQIGISLAILLVFLILRKLFTRYFFNLLFNLTNRPKTEIFKQVVLA
FDKPARWFFVALGLFLAIRYSPFLDEQMPVISKIYRSLIVALLCWGLCNLTATSSFIFHK
VNQRFELDMDDILAPFLSKLLRFVIIALSVSVIAQEFNYDVNGFVAGLGLGGLAFALAAK
DTISNFFGGIIIITEKPFTIGDWVETSTVTGSVEDITFRSTRFRTAQGALVTVPNSTLSM
EAITNWTRMTKRQITFSIHVSYATPIENLERSIHSLRTMLLEHEGVDNEIIMVNFDTFAD
SYYNLFFNFYTKTTVWAENLNIREDINYKIIEILGAEGVQFAYPGQMVVVKQKHESDQFQ
VNLNKEEKERA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccggattatctgcagcagtattttacgcttgataacatcatacaaatcggcatcagc
ttggcgattttgctggtgtttcttatacttagaaaattattcacaagatatttttttaac
ctgctttttaatttgacaaaccggccgaaaacagaaatttttaaacaggtggttctggcg
tttgataagccggccagatggttttttgttgcccttgggctgtttttagcgatccggtat
tcaccgtttttagatgagcaaatgccggtcatcagcaaaatataccgctcactgattgtg
gcgctcttgtgttggggtctttgtaatttgaccgcaacatcgtcgtttatcttccataag
gtgaaccagcgcttcgagcttgacatggatgacattctggccccgtttttatccaaattg
ctccgttttgtgatcattgcgctcagtgtcagtgtgatcgctcaggaattcaattatgat
gtcaacggatttgtagcgggccttggtcttggcggactggcttttgcgcttgccgcgaag
gataccatcagcaacttcttcggcggtattatcattattactgaaaagccgtttacaatt
ggtgactgggtggagacgtcgacagtaacaggatcagtcgaggatattacctttaggagc
acgagattcagaacagcacagggggcgcttgtaacggtgccgaactctacgctgtcgatg
gaagcgatcacgaactggacaagaatgaccaaacgccagattacgttttccatccatgtg
tcctacgctacgccgattgagaaccttgaacgctccattcattctctcagaacaatgctc
ttagagcatgagggcgttgataatgaaataatcatggtcaactttgatacgtttgccgac
agctactacaatttattttttaacttctatacaaaaacgacggtttgggctgaaaacctt
aatattagagaggatatcaactataaaattattgagattttaggtgcagaaggcgttcag
tttgcatatcccggccaaatggttgttgtcaagcaaaagcacgaaagcgaccaattccag
gtgaatctaaataaagaggaaaaggaacgggcttaa

DBGET integrated database retrieval system