KEGG   Bacillus subtilis subsp. subtilis 168: BSU09650
Entry
BSU09650          CDS       T00010                                 

Symbol
yhdZ
Name
(RefSeq) NAD-dependent protein deacetylase
  KO
K12410  NAD-dependent deacetylase [EC:2.3.1.286]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU09650 (yhdZ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     BSU09650 (yhdZ)
SSDB
Motif
Pfam: SIR2 TPP_enzyme_M
Other DBs
NCBI-GeneID: 936271
NCBI-ProteinID: NP_388846
Pasteur: BG13032
BSORF: BG13032
UniProt: O07595 A0A6M4JHV4
Position
1040094..1040837
AA seq 247 aa
METFKSILHEAQRIVVLTGAGMSTESGIPDFRSAGGIWTEDASRMEAMSLDYFLSYPRLF
WPKFKELFQMKMSGSFEPNEGHLLLAELEKQGKQVDIFTQNIDGLHKKAGSRHVYELHGS
IQTAACPACGARYDLPHLLEREVPECTAAGNNGDICGTVLKTDVVLFGDAVMHFDTLYEK
LDQADLLLVIGTSLEVAPARFVPEDASLIPGMKKVIINLEPTYCDSLFDMVIHQKIGEFA
RSLGMKK
NT seq 744 nt   +upstreamnt  +downstreamnt
ttggaaacattcaaaagtattctacatgaagcacagagaattgttgtgctgaccggagcg
ggaatgagcacagaatcagggatccccgactttcgttcagcagggggcatttggacggag
gatgcctcaagaatggaagcgatgagccttgattattttttaagttatccgcgtctgttt
tggcccaaattcaaagaattgttccagatgaaaatgagcggcagctttgaaccgaatgaa
ggccatttgcttttagctgagctggagaagcaagggaagcaggtcgatattttcacgcaa
aacattgacggtcttcataaaaaagcggggagcaggcatgtgtacgaactgcatggttct
atccagacagcagcttgtccggcatgcggcgcccgatatgatcttccccatttgctggag
cgggaggtgccggagtgcacggcggccggaaacaatggggacatttgcggaacggtatta
aaaaccgatgttgttctctttggcgatgccgtcatgcactttgacaccctttatgaaaag
ctggatcaagcagatcttttattggttatcggcacgtctctcgaagtggctccggctaga
tttgtgcctgaggatgcaagcctgattcccggcatgaagaaagtcatcataaaccttgaa
ccaacgtattgcgacagcttgtttgacatggtcatccatcaaaaaatcggcgagtttgcc
cgaagtttgggcatgaaaaagtga

DBGET integrated database retrieval system