KEGG   Bacillus subtilis subsp. subtilis 168: BSU09660
Entry
BSU09660          CDS       T00010                                 

Symbol
yheN
Name
(RefSeq) polysaccharide deacetylase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Polysacc_deac_1 DUF2334 UPF0242 TFIID_NTD2
Other DBs
NCBI-GeneID: 936280
NCBI-ProteinID: NP_388847
Pasteur: BG13046
BSORF: BG13046
UniProt: O07596 A0A6M4JES3
Position
complement(1040861..1041709)
AA seq 282 aa
MRQTRGEASPSAVSLAFKFASLAVLCVLLLLMVILGYSNSSTKAKEVTVTTNGQLRDEKE
SLKLKNDSPDLLIKHLQTKQNMGDKTVYLTFDDGPSAVTTRLLDVLKSADVKATFFMLSP
RMNEFKQAVKRAEKEGHALGLHGVTHNNRLFYQTPTSPLKEMQEARDTLQDITGYKTDLV
RTPYGSKPSLTASQIRNLEKDGFVYWDWTIDSMDWKYRNSQYVTAVLQQLENMEHSSSSR
PNVILMHDLPATVNALPVLINKLKEKGYSFGVLEDTMVPVHE
NT seq 849 nt   +upstreamnt  +downstreamnt
atgcgacaaacgagaggagaggcttctccttctgcagtttcgcttgcttttaaatttgca
agtttagcagttttatgtgtgctgcttttgcttatggtgattttgggttattccaacagt
tcaacgaaagcaaaggaagtcactgtcacaacaaacggccagcttcgagatgagaaggaa
agccttaagctgaaaaacgactcccccgatctcctgataaaacatctgcagacaaagcag
aacatgggagataaaacggtttacttaaccttcgacgacggcccttcagccgttacaacc
cgcttgctcgacgtactgaaaagcgctgatgtaaaagcgacgttttttatgctgtcaccg
cggatgaacgaattcaagcaggctgtgaaaagagcagaaaaggaaggccacgcactcggt
ttacatggcgttacccacaataacagattgttctatcaaacaccgacatctccgctaaaa
gaaatgcaggaggcgcgtgacacgctgcaggacattacaggatataaaaccgatcttgtc
agaacgccatacggaagcaagccgtcactaaccgcctcacaaattcgcaatctggagaaa
gatgggtttgtgtactgggattggacgatcgacagcatggactggaaataccggaattca
cagtatgtgaccgccgtattacagcagcttgagaatatggaacacagctcttcaagccgc
ccaaatgtaattctcatgcatgatcttcctgctactgtaaatgcgctgccggtactaatc
aataaattaaaagaaaaaggctattccttcggagtgttagaggacacaatggttcctgtt
catgaataa

DBGET integrated database retrieval system