KEGG   Bacillus subtilis subsp. subtilis 168: BSU09670
Entry
BSU09670          CDS       T00010                                 

Symbol
dat
Name
(RefSeq) D-alanine aminotransferase
  KO
K00824  D-alanine transaminase [EC:2.6.1.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00310  Lysine degradation
bsu00330  Arginine and proline metabolism
bsu00360  Phenylalanine metabolism
bsu00470  D-Amino acid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    BSU09670 (dat)
   00330 Arginine and proline metabolism
    BSU09670 (dat)
   00360 Phenylalanine metabolism
    BSU09670 (dat)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    BSU09670 (dat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU09670 (dat)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.21  D-amino-acid transaminase
     BSU09670 (dat)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class IV
   BSU09670 (dat)
SSDB
Motif
Pfam: Aminotran_4 Flavi_NS1
Other DBs
NCBI-GeneID: 939759
NCBI-ProteinID: NP_388848
Pasteur: BG13045
BSORF: BG13045
UniProt: O07597 A0A6M3Z924
Position
1041994..1042842
AA seq 282 aa
MKVLVNGRLIGRSEASIDLEDRGYQFGDGIYEVIRVYKGVLFGLREHAERFFRSAAEIGI
SLPFSIEDLEWDLQKLVQENAVSEGAVYIQTTRGVAPRKHQYEAGLEPQTTAYTFTVKKP
EQEQAYGVAAITDEDLRWLRCDIKSLNLLYNVMTKQRAYEAGAFEAILLRDGVVTEGTSS
NVYAVINGTVRTHPANRLILNGITRMNILGLIEKNGIKLDETPVSEEELKQAEEIFISST
TAEIIPVVTLDGQSIGSGKPGPVTKQLQAAFQESIQQAASIS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaaggttttagtcaatggccggctgattgggcgcagtgaagcatcaatcgatttggaa
gatcgcggttatcagtttggtgacggcatctatgaagtgatcagggtgtacaaaggagta
ttgttcggcttacgtgagcatgcagagcgttttttcagaagtgctgctgaaatcggaatt
tcactgccattcagtatagaagatctcgagtgggacctgcaaaagcttgtacaggaaaat
gcggtcagtgagggagcggtatacattcagacaacaagaggtgtggccccgcgaaaacac
cagtatgaagccggcctcgagccgcagactactgcctatacgtttacggtgaaaaaaccg
gagcaagagcaggcatacggagtggcggccattacagatgaggatcttcgctggttaaga
tgtgatatcaaaagtctgaatttactgtataatgtcatgacgaagcaaagggcctatgaa
gccggagcatttgaagccattttacttagggacggcgttgttacggagggtacatcctct
aacgtttatgccgttatcaacggcacagtgcgaacacatccggctaatcggctcattctc
aatggaattacacggatgaatattttaggactgattgagaagaatgggatcaaactggat
gagactcctgtcagtgaagaagagttgaaacaggcggaagagatctttatttcgtcaacg
acggcagaaattattccggtcgtgacgctcgatggacaatcgatcggaagcgggaaaccc
ggaccggtgaccaaacagcttcaggctgcttttcaagaaagcattcaacaggctgctagc
atttcataa

DBGET integrated database retrieval system