KEGG   Bacillus subtilis subsp. subtilis 168: BSU09690
Entry
BSU09690          CDS       T00010                                 

Symbol
nhaX
Name
(RefSeq) stress response protein NhaX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Usp
Other DBs
NCBI-GeneID: 939286
NCBI-ProteinID: NP_388850
Pasteur: BG13043
BSORF: BG13043
UniProt: O07552 A0A6M4JEE2
Position
complement(1044373..1044873)
AA seq 166 aa
MFHADRIIVAFDGSENSKKALLTAIDLAKTVNAAITVAHSHDMKDNQTVIDPPRPAAEAS
YISGGMTSVPDPLISDVTSPEPMIYEDRTEEVIAEARMMLNEQQADGDIDILEGDPAESI
IEHANRISADMIVTGSRDQNRLKKLIFGSVSEKLSAKSDIPVLIVK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgttccatgctgaccgtatcattgttgcgtttgacggaagtgaaaatagtaagaaagcg
cttctgacagccattgatcttgctaaaaccgtaaatgccgctattaccgtcgcccattca
catgatatgaaagacaatcagaccgtcatcgacccgcccagacccgcagctgaggcaagc
tatatcagcggaggcatgacaagtgttcctgatccgctgatatcggatgtaacatcacct
gagccaatgatctatgaagaccgtacggaagaagtcatcgccgaagccagaatgatgctg
aatgaacagcaggcagatggagatatcgatatattagaaggcgatccggctgaatcaatt
atcgagcatgcaaaccgcatttctgccgatatgatcgtaaccggaagcagagaccaaaac
aggctgaaaaagctaatattcggaagtgtaagtgaaaagctttcagcgaaatcggatata
cccgtcctgattgtaaagtga

DBGET integrated database retrieval system