KEGG   Bacillus subtilis subsp. subtilis 168: BSU09700
Entry
BSU09700          CDS       T00010                                 

Symbol
yheJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939757
NCBI-ProteinID: NP_388851
Pasteur: BG13042
BSORF: BG13042
UniProt: O07551 A0A6M3ZI78
Position
1045037..1045198
AA seq 53 aa
MFIKQFHIGAANLLFCFRERFFRSDRALKSAVRNISVKKGMELTLHAFFIYKI
NT seq 162 nt   +upstreamnt  +downstreamnt
gtgtttatcaaacagtttcatattggcgcggcaaaccttttgttctgttttcgtgaacgg
ttttttaggtcggaccgcgcgctgaaaagcgctgtgcgtaacatatcggttaaaaaaggc
atggagctgacgcttcatgccttttttatatacaaaatctaa

DBGET integrated database retrieval system