KEGG   Bacillus subtilis subsp. subtilis 168: BSU09730
Entry
BSU09730          CDS       T00010                                 

Symbol
yheG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NAD_binding_10 Semialdhyde_dh NmrA DapB_N Ldh_1_N Sacchrp_dh_NADP KDGP_aldolase DUF3886
Other DBs
NCBI-GeneID: 939755
NCBI-ProteinID: NP_388854
Pasteur: BG13039
BSORF: BG13039
UniProt: O07548 A0A6M4JH01
Position
complement(1049142..1049762)
AA seq 206 aa
MKIALLGASGRVGQAFLTQAAADERFDIFALIRSQHADLPLSKDRTVMGNARRLEDVKKI
MENAEIVISCLGTDGDDTLSTAMAHILSVMEEQHIKRLITIGTAGILDSRYEPGKYRFET
NESKRKQTRAAKEHAKVYEMLKESSLDWTIICPTYLPDGTATGVYRTERNVLPEGGTSIS
VGDTADFLYRELVTGEYVGNRVGLAY
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaaaatcgctttattaggagccagcggccgcgtcggacaagcctttttaacacaagct
gcagcagatgaaagatttgatattttcgctctgatcagatctcaacatgctgatcttccc
ctttcaaaagacagaactgtcatggggaacgcccgccgcttagaagatgtgaaaaaaata
atggagaatgctgaaatcgtgatcagctgtctaggcacagatggtgatgataccttgtca
actgctatggcacacattctctccgttatggaggaacagcatatcaaacggcttattacg
atcggcaccgcagggatcctagattcccgatatgaaccgggaaaataccggtttgaaaca
aatgaatcgaaacgaaagcagacccgcgcagccaaggagcatgcaaaagtatacgaaatg
cttaaagaatcatcattagactggacaatcatctgccccacttacctcccggacggaaca
gcaaccggcgtttatcgtacggagcgtaacgttttgcctgagggcggcacaagcatttcg
gtcggcgatactgcggactttttatatcgtgagctcgttacaggtgagtatgtcggaaac
cgtgtcggactggcttattga

DBGET integrated database retrieval system