KEGG   Bacillus subtilis subsp. subtilis 168: BSU09740
Entry
BSU09740          CDS       T00010                                 

Symbol
yheF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936277
NCBI-ProteinID: NP_388855
Pasteur: BG13038
BSORF: BG13038
UniProt: O07547 A0A6M4JGW6
Position
complement(1049801..1049926)
AA seq 41 aa
MSFITIVNWELVQFVSVSMIHEYVSHRSVYLYRYSFPRCSN
NT seq 126 nt   +upstreamnt  +downstreamnt
gtgtcattcatcaccattgtgaattgggagctggttcaattcgtaagtgtatccatgatt
catgaatatgtttcccatcgttctgtttatttgtacaggtattctttcccgcgctgttca
aactga

DBGET integrated database retrieval system