KEGG   Bacillus subtilis subsp. subtilis 168: BSU09750
Entry
BSU09750          CDS       T00010                                 

Symbol
sspB
Name
(RefSeq) small acid-soluble spore protein B
  KO
K06419  small acid-soluble spore protein B (major beta-type SASP)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU09750 (sspB)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-GeneID: 939281
NCBI-ProteinID: NP_388856
Pasteur: BG10787
BSORF: BG10787
UniProt: P04832 A0A6M4JGG1
Position
complement(1050031..1050234)
AA seq 67 aa
MANQNSSNDLLVPGAAQAIDQMKLEIASEFGVNLGADTTSRANGSVGGEITKRLVSFAQQ
QMGGRVQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggctaaccaaaactcttcaaatgacttactagttcctggcgcagctcaggctatcgat
caaatgaaacttgaaatcgcttctgaattcggcgttaaccttggagcggacacaacttct
cgcgctaacggttctgtcggaggagaaatcacaaaacgtttagtatctttcgctcagcag
caaatgggcggcagagttcaataa

DBGET integrated database retrieval system