KEGG   Bacillus subtilis subsp. subtilis 168: BSU09760
Entry
BSU09760          CDS       T00010                                 

Symbol
yheE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5342
Other DBs
NCBI-GeneID: 939756
NCBI-ProteinID: NP_388857
Pasteur: BG13037
BSORF: BG13037
UniProt: O07546 A0A6M4JHW4
Position
complement(1050443..1050661)
AA seq 72 aa
MAVMISHFSWKPLFPKEKLPGWKISFYYKGTHYEGIYHKSGEIEWGDLFPARADEPALTN
EIHELMLFHIYD
NT seq 219 nt   +upstreamnt  +downstreamnt
gtggccgtaatgatttctcatttcagctggaaacctttgttcccaaaagaaaagctgccc
ggatggaaaatttcattttattataaagggacccattatgaaggcatctatcataagagc
ggtgagattgaatggggagacttgtttcccgcccgcgctgacgagcctgctcttacaaac
gagatacatgaactgatgctttttcatatttatgactag

DBGET integrated database retrieval system