KEGG   Bacillus subtilis subsp. subtilis 168: BSU09770
Entry
BSU09770          CDS       T00010                                 

Symbol
yheD
Name
(RefSeq) endospore coat-associated protein YheD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ATPgrasp_YheCD ATPgrasp_ST TTL
Other DBs
NCBI-GeneID: 936276
NCBI-ProteinID: NP_388858
Pasteur: BG13036
BSORF: BG13036
UniProt: O07545 A0A6M4JET3
Position
complement(1050811..1052172)
AA seq 453 aa
MNPKRFLIGIDKTSENTLFLPSSLKQDGLLHAAFGTKVVRCHVAYRRHLEQTVLLSENLF
HELLLPHRSRADILIHDHTVHIGPLVGIFTAGFTVSLERPFKDRSLFFSKLVTLHEQAGG
YCFVFGAHQINWEEGTIEGLLYRENGWEKKIVPLPNVVYDRLPNRKIEDSLLLQHTKKRL
IDEYQIPWFNKTFFNKWNVHQLLEKDPRTAPFLPRSELTPSVELIDELCGAYKKVYIKPA
NGALGTGIYQLTRTDGGLTVKHTNDAKTFTSIDYSDAASFLAEFQKHHNPSDFLIQQGVD
LIEFQGKPADFRVHTNKNRKGKWTVTAIAVKISGKNSITTHLSNGGTVKTLAEVYDDPAE
RVEVIKKLSAAALTASHVLHDHIEGFIGEIGFDFGIDQNGKVWMFEANSRPGRSIFSHPN
LHHVDSLTKRRSFEYASYLSEKAITSPEALWPS
NT seq 1362 nt   +upstreamnt  +downstreamnt
gtgaatcctaaacggtttttgatcggcatagacaaaaccagtgaaaacaccctgtttctg
ccctcttcgctgaagcaagacggacttttgcatgccgcattcggaacgaaggttgtcaga
tgccacgttgcttacagacggcatctggaacaaaccgtgcttctctctgaaaatctgttt
catgagcttttgcttccccaccgaagcagggcagatatactgattcatgatcatacagtg
catatcgggccgttagtcggcatctttacggcagggtttactgtatctcttgaacgccca
tttaaggatcgttccctctttttttctaaacttgtcacgttacacgagcaagccgggggc
tactgcttcgtttttggcgcgcaccaaatcaattgggaggaaggcacgattgaaggcctc
ctttacagggaaaacggctgggagaaaaaaatcgttccattgccgaacgtcgtttatgac
cgtttgccgaaccgaaaaattgaagattcacttctcttgcaacatacaaaaaagaggctg
atcgatgaatatcagatcccatggtttaataaaacgtttttcaataaatggaacgttcat
caattgctcgaaaaagatccaagaacggcaccctttttgcctagatccgagctgacaccg
tctgtggagctgatagatgagctctgtggcgcatacaaaaaagtctatatcaaaccggca
aatggagcactcggcaccggcatttatcagctgacaagaacagatggcggcctgacggta
aagcatacgaatgacgccaaaacttttacatcaattgattattccgatgccgcctcattc
cttgcagaatttcaaaaacatcacaacccgtccgactttctcattcagcaaggtgttgat
ctcatcgaatttcaaggcaaaccagcggatttccgtgtccataccaataaaaacagaaaa
ggaaaatggacagtgacagcaatcgccgtaaaaatttccggaaagaacagcattacaaca
catctttctaacggcggcactgtaaagacacttgcggaagtatacgatgatcccgctgaa
agagttgaggtcattaaaaagctttctgcagcggcactgactgcaagccatgtccttcat
gatcatatcgagggatttatcggggagattggtttcgattttggcattgatcagaacggt
aaagtatggatgtttgaagcgaattcgcgcccgggccgaagcattttttctcatccaaat
ttgcatcatgttgattctcttacaaaacgaagaagttttgaatacgcgtcatatttatct
gagaaggcaatcacatctccggaagcattgtggccttcgtaa

DBGET integrated database retrieval system