KEGG   Bacillus subtilis subsp. subtilis 168: BSU09780
Entry
BSU09780          CDS       T00010                                 

Symbol
yheC
Name
(RefSeq) endospore coat-associated protein YheC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ATPgrasp_YheCD GSH-S_ATP ATP-grasp_3 TTL
Other DBs
NCBI-GeneID: 939293
NCBI-ProteinID: NP_388859
Pasteur: BG13035
BSORF: BG13035
UniProt: O07544 A0A6M4JLK4
Position
complement(1052162..1053253)
AA seq 363 aa
MITLGFMSLSRQHEADYSAELAKRAPEFGIRFIRFTPFDISPDTLRVKASVYHSASSTWN
ETEMAIPDYIYDRCFYGKDSHSQKAKPIVEWLKKYPKTEFIGRGLPDKWTVLHDLQQHSV
INPYIPETIKVSRYEQIHSFLSKEKACILKPAFGAGGRGVILLKLGKKNITATYHIGKDK
QTKTFSNQTSFKTWCKKVLQHQYLLQPYLNIQDKEQYPCDIRLFMEKNEAGEWNTVGKAV
RRGYKHGLLANLSGGSDALTFDSWFEDIPKKQQVVLLDDVFSITQSVPYYLDERYGPLFE
LGLDICLAKDGRIWILDINSKPGRKSILRVSPEQKEQLYTCPLKRCQYLFSEQSQKGVLP
RES
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgataacactcggttttatgtccttatcccgccagcatgaagcggattattccgcagaa
ctggccaaaagagcacccgaattcggcatacgtttcatccggtttacaccatttgatatt
tcacctgacactttgcgtgtcaaagcatcggtctatcattcggccagcagcacatggaac
gaaactgaaatggcgattccagattatatttatgatcgctgtttttacggcaaggattca
cattcccaaaaagcaaaaccaatcgttgagtggctcaaaaaatatccgaaaacggaattt
atcgggcggggtcttcccgataagtggaccgtccttcacgatttgcagcagcactctgta
atcaatccctatattcccgaaacgataaaggtgagccgctacgaacaaattcactccttt
ttatccaaagaaaaagcctgcatccttaaaccggcattcggcgcgggaggcagaggcgtg
attcttttgaagctgggcaagaaaaacatcactgctacttatcacatcggaaaggataag
cagacaaaaacgttttccaaccagacttcttttaaaacatggtgcaaaaaagtgcttcag
catcaatatttgcttcagccttacttaaacattcaagataaggaacaatacccttgtgat
attcgtctgtttatggaaaaaaacgaagcaggtgaatggaatacagtcggaaaggcagta
agacgcggatacaaacacgggctgctggccaatttgtcaggcggatctgatgcgctgaca
tttgactcctggtttgaagatataccgaaaaaacagcaagtggttttactagatgatgtg
ttttcaattacccaatcggttccgtattatcttgacgagcgctatgggccgttgtttgaa
ctcggtcttgatatatgtcttgcaaaggacgggagaatttggattttagatatcaattcc
aaaccaggcaggaagtcaatcctgcgtgtctctcccgagcaaaaagaacagctgtacact
tgtcccctaaaacgctgccaatatctgttttctgagcaaagccagaaaggagttcttccg
cgtgaatcctaa

DBGET integrated database retrieval system