KEGG   Bacillus subtilis subsp. subtilis 168: BSU09790
Entry
BSU09790          CDS       T00010                                 

Symbol
yheB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF445 DUF1761 SAC3
Other DBs
NCBI-GeneID: 939764
NCBI-ProteinID: NP_388860
Pasteur: BG13034
BSORF: BG13034
UniProt: O07543 A0A6M3Z8Z7
Position
1053520..1054653
AA seq 377 aa
MGIAGTFIFMIVIGAAIGAVTNHLAIQMLFRPYKAYYLFGKRVPFTPGLIPRRRDELAKQ
MGLMVVNHLLTPEGIKKRLVSDAAKTQALRVGEQLIQKLSLSEVTVKEALEKAGMKRPEK
AADAWISSWTDDKLHELFRQYGDQSLKELVPIEVQEKLEEKIPMISGYILSRSVRYFESD
EGKIRLGNMIDDFLKERGMLGSMVQLFLGNSSLADRVLPELLKFLRNEETNKLLSDLLKN
EWGKLREYTFNEADEKWNAKALIFSLKRRVLQAFSTAPFFNNTIGTLTVRYESELTQQML
PALLDKLLEGISSNLESVLKRLRLEEIVKEQVDQFPVERLEEMVLSISKKEFKMITYLGG
LLGGIIGAIQALFVILF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgggtattgcaggaacctttatttttatgatcgtgatcggcgctgccattggagcggtg
accaatcatttagcaattcaaatgctgtttaggccgtataaagcgtactatttgtttggg
aaacgagttccttttacgcccgggctgattccaagacggcgagatgaacttgcaaaacaa
atgggactgatggtagtcaatcatctcttaacccctgaaggcattaaaaagcggctcgtc
tctgatgcagccaaaacgcaggctcttcgagtgggggaacagctgattcaaaagctgtca
ctttctgaagtgacagtaaaagaagcgcttgaaaaagccgggatgaagcgccccgaaaaa
gctgctgatgcatggatcagcagctggaccgatgataagctgcatgagcttttccgccaa
tacggggaccaatcgttaaaagagctggtgcctatagaggtgcaggaaaagcttgaggaa
aaaattccgatgatttcaggatatatattgtcacggagtgtccgttattttgaaagtgat
gaaggaaaaatccgtcttggcaatatgattgatgactttttaaaagagcgcggcatgctt
ggaagcatggtgcaattgtttcttggcaattcaagccttgcggatcgcgtgctgccggag
ctgctgaaattcttgcgcaatgaggaaacaaataaattgctttctgatctcttaaaaaac
gaatggggcaagctgagggagtatacgtttaatgaagcagatgaaaaatggaatgcaaag
gcgctcattttcagtttgaaacgaagagtgctgcaagcattttcgactgcccctttcttc
aacaatacgattggcacgcttaccgtccgctatgaatctgagctgacccagcaaatgctg
ccggcactattagacaaattgcttgaaggtatttcgtccaaccttgaaagtgtcttaaaa
cggttgcgtcttgaggaaatcgtcaaggagcaggtggatcagttcccggtggagcgtctt
gaagaaatggtgctgtccatttcaaaaaaagaatttaaaatgattacctatttggggggc
cttctcggcggaattataggcgcgattcaagcattgtttgtcatccttttttaa

DBGET integrated database retrieval system