KEGG   Bacillus subtilis subsp. subtilis 168: BSU09800
Entry
BSU09800          CDS       T00010                                 

Symbol
yheA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Com_YlbF DUF2353 Flagellin_N
Other DBs
NCBI-GeneID: 936288
NCBI-ProteinID: NP_388861
Pasteur: BG13033
BSORF: BG13033
UniProt: O07542 A0A6M4JEF4
Structure
PDB: 
2OEE

Position
1054746..1055099
AA seq 117 aa
MAVNFYDVAYDLENALRGSEEFTRLKNLYDEVNADESAKRMFENFRDVQLRLQQKQMAGE
EITQEEVTQAQKTVALVQQHEKISQLMEAEQRMSMLIGELNKIIMKPLEELYGSVEG
NT seq 354 nt   +upstreamnt  +downstreamnt
atggctgttaatttttatgatgtagcgtatgatctggaaaatgcattacgcgggagcgaa
gaattcacccgtttaaaaaacctttacgacgaagttaacgcagatgaatcagcgaagcgc
atgttcgaaaacttccgtgatgtacagcttagactccagcaaaaacaaatggcaggagaa
gagattacacaagaagaagtgacgcaggctcaaaaaacagttgcgcttgtacagcagcac
gaaaaaatttctcagctgatggaagcggagcagcgcatgagcatgctgattggtgaattg
aacaaaatcattatgaagcctttagaagagctttacggcagtgttgaaggctaa

DBGET integrated database retrieval system