KEGG   Bacillus subtilis subsp. subtilis 168: BSU09810
Entry
BSU09810          CDS       T00010                                 

Symbol
yhaZ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DNA_alkylation HEAT HEAT_2
Other DBs
NCBI-GeneID: 939758
NCBI-ProteinID: NP_388862
Pasteur: BG13002
BSORF: BG13002
UniProt: O07541 A0A6M3Z903
Position
complement(1055143..1056216)
AA seq 357 aa
MADLKEIYNEELISQLIHHVRSSYPDFNKNRFLDTLRLEDWPELTLKERMRRVTVSLYET
LPKQYVEALTILRDTAPHFKGLSGILFPDYVEQYGLAHWEESIKALESFTQYSTSEFAVR
PFLLLDQEKMIAQLLAWSEHKNEHVRRLASEGSRPRLPWGKSIPALKSDPSPVLPILEKL
MQDESLYVRKSVANNLNDISKTHPHLLRKVADQWYGTHPHTDWIIKHAYRTLLKKGDKQA
LALFGYENADSIQLHDLTCQPKRIVIGESLEFSFYIHSDRDQKVRIEYAIDFVKARGQRH
QKVFKITETNIRKNETKSYTRIQSFKDLTTRKHYKGIHTLSVIINGEVKDSLDFQVC
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggctgatttaaaagaaatatataatgaagaactgatatctcagttgatccatcatgta
aggtcatcctatcctgattttaacaaaaacagattcttggatacattacggctggaggac
tggcctgaactcactttaaaagagcggatgcgccgcgtgacagtttctttatacgaaact
ttgccaaaacaatacgttgaagcgctcacaattttacgggatacagcccctcattttaaa
ggactcagcggaattttatttccagattatgtggaacagtacgggttagcgcattgggaa
gaatcaataaaggcattggaatcctttacgcaatattcgacctcagaatttgctgtaagg
ccttttttgctgttagatcaagaaaagatgattgcacaattgcttgcatggtctgagcat
aaaaatgaacacgtgagaagacttgcgagcgaaggcagcaggccccgcctgccatgggga
aaatcgataccggctttgaaatcggacccttcccccgtattgccgatccttgagaagctg
atgcaggacgagtctttatatgtaagaaaaagcgtggccaacaaccttaatgatatatca
aaaacgcatcctcatttactgagaaaagtcgcagatcaatggtacggaacacatccccat
acagactggattatcaaacacgcctatcggaccttattaaaaaagggtgataaacaggcc
ttagcgctttttggttatgaaaatgctgattcgatacaactacatgatttaacatgccag
cccaaacgtatagttattggcgaaagccttgaattttctttctatattcattcagacagg
gatcaaaaagtaagaattgagtacgcaattgattttgtaaaagcaagaggccagcgtcat
cagaaagtatttaaaataacagaaacaaatatacgaaaaaacgaaacgaagtcatacaca
agaatccaatcctttaaggatttaaccaccagaaagcattacaaaggaattcatacatta
tcagtcatcatcaatggagaggtaaaagattcattggatttccaagtttgctga

DBGET integrated database retrieval system