KEGG   Bacillus subtilis subsp. subtilis 168: BSU09830
Entry
BSU09830          CDS       T00010                                 

Symbol
yhaX
Name
(RefSeq) hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Hydrolase_3 S6PP Hydrolase_6 Hydrolase
Other DBs
NCBI-GeneID: 939288
NCBI-ProteinID: NP_388864
Pasteur: BG13000
BSORF: BG13000
UniProt: O07539 A0A6M4JGK5
Structure
Position
1056702..1057568
AA seq 288 aa
MSKQLLALNIDGALLRSNGKIHQATKDAIEYVKKKGIYVTLVTNRHFRSAQKIAKSLKLD
AKLITHSGAYIAEKIDAPFFEKRISDDHTFNIVQVLESYQCNIRLLHEKYSIGNKKKVNS
NLLGKALIHPSDPIFYPVQFVESLSDLLMDEPVSAPVIEVYTEHDIQHDITETITKAFPA
VDVIRVNDEKLNIVPKGVSKEAGLALVASELGLSMDDVVAIGHQYDDLPMIELAGLGVAM
GNAVPEIKRKADWVTRSNDEQGVAYMMKEYFRMQQRKGFLDKFHMKRV
NT seq 867 nt   +upstreamnt  +downstreamnt
gtgtcaaaacaattgcttgccttaaatatagatggagcgctgcttcggtcgaacgggaag
attcatcaggcaacgaaagacgcgattgaatatgtaaagaaaaaagggatttacgtcaca
cttgtgaccaaccgtcattttcgctcagcacagaaaatagcgaaatcgctaaagcttgat
gccaagctgatcacccatagcggggcatatatcgctgagaaaattgacgccccgtttttt
gaaaaaagaatttctgatgatcatacctttaacattgttcaagtgctggagagctatcaa
tgcaatattcggcttcttcacgaaaagtattccatcggaaacaagaaaaaggtgaattcg
aatttattagggaaagcactcattcatccgtctgacccgatcttttatccagtccagttc
gttgaatcattaagcgatctcctcatggatgagccggtgagtgcacccgtcatcgaggtg
tacacggagcacgacattcagcatgacattacagaaacgattacaaaagccttccctgcg
gtggacgtgattcgcgtaaacgatgagaaactgaatatcgtcccgaagggtgtctcgaag
gaagcgggtttggccctcgtcgcttcagagctgggcctgagtatggatgatgtcgtggcc
attgggcatcagtatgacgatctgccgatgatcgaacttgccggtcttggggtagcgatg
gggaatgccgttccggaaattaagagaaaggcagattgggttacaaggtccaatgacgag
caaggtgtcgcttatatgatgaaggaatatttccgaatgcagcagcgaaaaggatttctt
gataagttccacatgaaacgtgtgtaa

DBGET integrated database retrieval system