KEGG   Bacillus subtilis subsp. subtilis 168: BSU09840
Entry
BSU09840          CDS       T00010                                 

Symbol
hemZ
Name
(RefSeq) oxygen-independent coproporphyrinogen-III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    BSU09840 (hemZ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BSU09840 (hemZ)
SSDB
Motif
Pfam: Radical_SAM
Other DBs
NCBI-GeneID: 937935
NCBI-ProteinID: NP_388865
Pasteur: BG12999
BSORF: BG12999
UniProt: Q796V8 A0A6M4JH12
Position
1057680..1059185
AA seq 501 aa
MQIKIEGIHDDRLHRPLQNIANLFYEECELAYGGEEPADFVISLALSQTDEHVTVSGEVK
GTGIKEQHTKFFSPDMTEKEAFKQVKNTISYVYLNLLQAHTGITQKWGILTGIRPTKLLH
KKLQSGMSKEQAHAELKKDYLIHDEKIMLMQEIVDRQLAAVPDLYRVKDEVSIYIGIPFC
PTKCAYCTFPAYAIQGQAGRVGSFLWGLHYEMQKIGEWLKEHDVKVTTIYFGGGTPTSIT
AEEMDLLYEEMVRSFPDVKNIREITVEAGRPDTITEEKLAVLNKYDIDRISINPQSYENE
TLKAIGRHHTVEETIEKYHLSRQHGMNNINMDLIIGLPGEGVKEFRHSLSETEKLMPESL
TVHTLSFKRASEMTRNKHKYKVAGREEVSQMMEDAVAWTKEHGYVPYYLYRQKNILGNLE
NVGYSLPGQESIYNIMIMEEVQTIIGIGCGAASKFIDRDTGKITHFANPKDPKSYNERFE
HYTDEKIKYLEQIFEKTTKQH
NT seq 1506 nt   +upstreamnt  +downstreamnt
ttgcaaattaaaatagaaggcatacatgatgaccgcctgcatcggcctctgcaaaatatt
gcaaatttgttttatgaagagtgcgagcttgcgtatggcggagaggagcccgcagatttt
gtcatttctttagcgttgtcacaaacggatgagcatgtgacggtttctggagaagtgaag
ggtactggcataaaggaacagcatacaaaattcttttctccagacatgactgaaaaagaa
gcttttaagcaagtgaaaaacacaatttcttatgtgtatctcaatcttcttcaggcgcat
acgggcattacgcagaagtggggaatcctcacaggaatccggcccacaaagctgcttcat
aaaaaactgcaaagcggaatgtccaaggagcaagcgcatgctgagttgaaaaaagactat
ttaattcatgatgaaaaaatcatgctaatgcaggaaattgttgaccgtcagctggcggca
gtgccggatttgtaccgagtaaaggatgaagtcagcatttatatcggcattccgttctgc
ccgacaaaatgcgcgtattgcacattccctgcgtacgctatccaaggacaggcgggcaga
gtcggctcattcctatggggactgcattacgaaatgcagaaaatcggtgaatggctgaag
gagcatgatgttaaggttacaaccatttactttggcggcgggacgccgacaagcattaca
gcggaggagatggatctgctgtatgaagaaatggtccgctccttcccggatgtgaaaaac
attcgtgagattacggtggaggccggtcgtcctgacacgattacagaagaaaaactcgcc
gttttaaacaaatatgacattgatcggatcagcatcaatccgcaatcctacgaaaacgaa
acgctaaaggcgatcgggcggcaccatacggttgaagagaccattgagaaatatcatctg
tcacgccagcacggcatgaataatattaacatggacttgattattggtttgcctggggaa
ggcgtgaaggagttcaggcacagtctttcagaaacagaaaaactgatgccggaatccctt
accgttcatactctttcatttaaacgggcgtcagaaatgacgagaaacaagcataagtac
aaagttgccggcagggaagaggtttctcaaatgatggaagacgcggtagcctggacgaaa
gagcatgggtacgtgccttattatttataccgccagaaaaacattcttggaaaccttgaa
aacgtcggatactctttgccgggacaagaaagcatctacaacattatgattatggaagag
gtgcagacgattattggcatcggctgcggcgctgctagtaaatttattgatcgggataca
gggaaaattacgcattttgcgaatccgaaagatccgaaatcgtacaatgagcgcttcgag
cactacacggacgaaaaaatcaaatatttagagcagatttttgaaaaaacgacaaagcag
cactga

DBGET integrated database retrieval system