KEGG   Bacillus subtilis subsp. subtilis 168: BSU09850
Entry
BSU09850          CDS       T00010                                 

Symbol
yhaU
Name
(RefSeq) K(+)/H(+) antiporter YhaU
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU09850 (yhaU)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 939761
NCBI-ProteinID: NP_388866
Pasteur: BG12997
BSORF: BG12997
UniProt: O07536 A0A6M3Z9E1
Position
complement(1059203..1060420)
AA seq 405 aa
MDHLVFEVGTALVLVAIASVIANKIKFSIIPFLIVLGMLVGPHAPKMGIIDLTFIQSSEI
IEFFGRMGVLFLLFYLGLEFSVGKLIKSGKSIAVGGTIYILINFSLGLLYGFITGFSFLE
VLILAGVITISSSAIVAKVLVDLKRTANPETELILGIIMFEDIFLAVYLSVVSGLILGDA
TSVGSALLSILIAFGYMLLFFIAARKLPPLLNKLLDIRSNEVFIIVIFAALFFIAGFSET
IHVAEAIGALLLGLVFSETEHSDRIEHLVVPFRDFFGAMFFFSFGLSIDPFSLGEAVWLA
LGAVILTILGNFIAGMVAGRRAGLSHKASSNIGLTIVSRGEFSIIVANLGIAGGLSATLK
PFAALYVLILAILGPLVTKESKRIYRLLNKVFKWKPEVQPAKKQG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggaccatcttgtatttgaagtcggaactgcacttgtgcttgtggcaatcgccagtgtg
atcgccaataaaattaaattttcgattattccgtttctgattgtgctgggaatgcttgtt
ggaccgcacgcgccgaaaatggggattattgatctaacatttattcaaagcagtgaaatc
atcgagtttttcgggcgaatgggcgtactgttcctcctcttctatctcggactcgaattc
tctgtcgggaagttaatcaaatcaggaaaatcaatcgcggtcggcgggacgatttatatt
ttgattaacttcagcctcggactgctttacgggtttatcaccggattttcctttctggaa
gtcctcatcctcgcaggcgtcatcacaatctcgtcaagtgcgattgtcgcaaaagtgctc
gttgatttaaaaagaaccgccaacccggaaaccgaattgattctcggcatcatcatgttt
gaagatattttccttgccgtatatctgtccgttgtttccggccttatactaggtgatgcg
acatccgtagggagtgcactcttgtccattttgatcgccttcggttatatgctgctgttt
tttatcgcagcaagaaaactcccgccgctgttgaacaaactgttggacattcgctcaaac
gaagtgtttattatcgtcattttcgcagcactcttttttatcgccggtttttcagagacg
attcatgtagcagaagcaatcggcgcgctgctgctcggtttggtcttttcagaaacagag
cattccgataggattgaacacctcgttgttccgtttcgcgacttcttcggtgcgatgttc
tttttcagcttcggcctcagcatcgatccgttttcgcttggtgaagcggtttggcttgcg
ttgggtgcagtgattttgaccattctgggaaattttatcgccggaatggtggcaggacga
cgcgcagggctttctcataaggcttcatcgaatatcgggctgacgatcgtatcgcgggga
gaattttcgattatcgttgcgaatctcgggatagccggcggactgtcggccacattaaag
ccgtttgccgcattatatgtcctcattctggcgattttgggaccgcttgtcacaaaggaa
tcaaaacgaatttaccgcttgctgaacaaggtatttaaatggaagcctgaggttcagccc
gcaaaaaaacagggataa

DBGET integrated database retrieval system