KEGG   Bacillus subtilis subsp. subtilis 168: BSU09860
Entry
BSU09860          CDS       T00010                                 

Symbol
khtT
Name
(RefSeq) K(+)/H(+) antiporter subunit KhtT
  KO
K07228  TrkA domain protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSU09860 (khtT)
SSDB
Motif
Pfam: TrkA_C Castor_Poll_mid Imm40
Other DBs
NCBI-GeneID: 936284
NCBI-ProteinID: NP_388867
Pasteur: BG12996
BSORF: BG12996
UniProt: O07535 A0A6M3ZEA4
Position
complement(1060427..1060924)
AA seq 165 aa
MNIKENDLPGIGKKFEIETRSHEKMTIIIHDDGRREIYRFNDRDPDELLSNISLDDSEAR
QIAAILGGMVYKPQALESIEMAFSDLIIEWFKVEKGAKSIGRTLGELDVRQNYDVTVIAI
IKHNQEKLLNPGADSIIEENDTLVLSGERKHLKKLIHDFLSGEGV
NT seq 498 nt   +upstreamnt  +downstreamnt
ttgaatattaaagaaaacgatctgccgggcatcggcaaaaagtttgaaatcgaaacaaga
agccacgaaaaaatgacgattatcattcatgatgacggaagaagggaaatttaccggttt
aatgaccgggacccggatgagcttctttcaaatatttcattggatgattctgaagcaagg
caaattgcagctattctcgggggcatggtctataaaccgcaagctctggagtccatcgaa
atggccttcagcgatcttattattgaatggtttaaggtcgaaaaaggcgccaaatcgatc
ggacgcacactcggtgagcttgatgttcgccagaattacgatgtcactgttattgcgatt
atcaaacacaaccaggaaaagctcctaaatcccggagcggattcgattattgaagaaaat
gacacccttgtcctctcaggtgagagaaagcatctgaagaaactgattcacgattttctt
tctggagagggcgtgtga

DBGET integrated database retrieval system