KEGG   Bacillus subtilis subsp. subtilis 168: BSU09870
Entry
BSU09870          CDS       T00010                                 

Symbol
khtS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939291
NCBI-ProteinID: NP_388868
Pasteur: BG12995
BSORF: BG12995
UniProt: O07534 A0A6M4JHX4
Position
complement(1060988..1061326)
AA seq 112 aa
MRREERNMDKLLISFLLSLFMVYFPPSDVVLPSQFEASTDSYVPMSSYPQETQSAKTPSP
GSMHPAELIKEYSPLAQSVRQLSVKPLDEPLINRLEKALAVPVKYQSNYLRI
NT seq 339 nt   +upstreamnt  +downstreamnt
atgagaagggaggaaaggaacatggataaattgctgatcagttttctgttaagtttattt
atggtgtactttcccccttcggacgtggttctgccttcccagtttgaagcaagcactgac
agctatgtgcctatgtcttcatatccgcaggaaacacaatcggcaaaaacgccatcgccg
ggcagcatgcacccggctgagctgatcaaagagtacagcccgctggcgcagtctgtcagg
cagctctctgtcaaaccacttgacgaaccgctgataaacaggctggaaaaggctttggcc
gtccctgtcaaataccagtctaattacctccgaatataa

DBGET integrated database retrieval system