KEGG   Bacillus subtilis subsp. subtilis 168: BSU09889
Entry
BSU09889          CDS       T00010                                 

Symbol
yhzD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YhzD
Other DBs
NCBI-GeneID: 8303023
NCBI-ProteinID: YP_003097698
UniProt: C0H3Y1 A0A6M4JLK9
Position
complement(1062279..1062464)
AA seq 61 aa
MADYFLTVFDPSGNTLVNEQFEAEHEEAAKTHGEALLKEKELHSHTHRLVNAAGKLILFH
R
NT seq 186 nt   +upstreamnt  +downstreamnt
atggctgattatttccttaccgtatttgatccttcggggaacacgctggtaaacgagcaa
ttcgaggcagaacatgaagaagcggcaaaaacgcatggtgaagccctcttaaaagaaaaa
gagcttcatagtcatactcatcgtttagtcaatgcagccggaaagctgattttgtttcac
agatga

DBGET integrated database retrieval system