KEGG   Bacillus subtilis subsp. subtilis 168: BSU09900Help
Entry
BSU09900          CDS       T00010                                 

Gene name
natB
Definition
(RefSeq) hypothetical protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09900 (natB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU09900 (natB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3
Motif
Other DBs
NCBI-GeneID: 939763
NCBI-ProteinID: NP_388871
Pasteur: BG12992
BSORF: BG12992
UniProt: O07523
Position
1063480..1064739
Genome map
AA seq 419 aa AA seqDB search
MNKFWIMLSHTYKNKIMAKSFIISTVITVLLVLVVTNLESIISLFQGDDAKEKIAVVDET
NELYPVFSKQLKAVDTDGDLDVKLSKQSEDEVTKQVKDESLDGMLIIKRDEKGTISGTYK
ALTISDESTYQTLQQALTQTKTAVGTAELGVSQETISSLYAPVTVGQKALKEGAKSEEEL
GQTVGLVYIMLFVIYFSVIMYASMIAMEVATEKSSRVMEILISSMPPIQQMFAKLLGIGL
VGITQLAIIIGAGSLSLKLNQKSETASSVGGFLNLTDVSATTVIYAVIFFLLGYFLYATL
AAFLGSVVSRIEDVQQTITPMTLLVVAGFMIAMFGLNAPDAGFITVTSFIPFFTPMIMFL
RVGMLDIPFWQAAVGIGITLLTIVILAVIGARIYKGGVLIYGNSSAFKAIKQALRLAKN
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattttggatcatgctttctcatacatacaaaaataagattatggcaaaatcc
tttattatttcgactgtcatcacggtgctgcttgttttagttgtaacgaatctggagtcg
atcatttctttgtttcaaggtgacgatgcgaaagaaaaaatcgccgttgttgatgaaaca
aacgaattatatccggttttttctaagcagctgaaagcggtggatacagacggcgatctt
gatgtgaagctgtcgaagcaatcggaggatgaggtcacaaagcaagtcaaagatgaatca
ctcgatggcatgctcatcatcaaacgagatgaaaaagggaccatttcaggaacatataaa
gcgttaacgatttctgatgaaagcacgtatcaaacactgcagcaggcgctgacgcaaacc
aaaacagctgtcggaacagcggagctcggcgtgtcgcaggaaacgattagcagcctttat
gcgcctgttactgtggggcagaaggcgctgaaagaaggggcaaagtctgaggaagagctt
ggccagacggtagggcttgtttacattatgctgttcgtcatttatttctcggtgattatg
tatgccagcatgatagcgatggaggtcgcaaccgaaaaatcttcgcgagttatggaaatc
ctgatctcaagtatgccgccgatccagcaaatgtttgcaaagctgcttggtatcgggctt
gtcgggatcacacagcttgctattattataggagccggctctctgtcgcttaagctgaac
caaaagagcgaaacggcttcatctgtcggcggattccttaatttgaccgacgtatctgca
accactgtcatctatgctgtcattttctttttgctcggatactttttgtacgcgacactt
gccgcgtttctcggcagtgtcgtcagcagaatagaggacgtgcagcaaacgatcacgccg
atgacgcttttggttgtcgccggttttatgatcgcgatgttcggtttgaatgcgcctgac
gcaggatttattacggtaacttcgtttattccgttctttacgccaatgattatgttcctg
cgcgtcggcatgcttgatattccgttctggcaggcggctgtcggaatcggaatcacactg
ctcaccattgtcatactggccgttatcggcgccagaatttataaaggcggtgtattaatt
tacggcaattcaagcgcgttcaaagcgatcaaacaagcgctacgtttagcgaaaaactga

DBGET integrated database retrieval system