KEGG   Bacillus subtilis subsp. subtilis 168: BSU09910
Entry
BSU09910          CDS       T00010                                 

Symbol
yhaO
Name
(RefSeq) metallophosphoesterase
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU09910 (yhaO)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSU09910 (yhaO)
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-GeneID: 936282
NCBI-ProteinID: NP_388872
Pasteur: BG12991
BSORF: BG12991
UniProt: O07522 A0A6M4JEM0
Position
1064846..1066072
AA seq 408 aa
MLTDLTFIHAADLHLDSPFYGISHLPEPIFARIKESTFASVRHMIDAAVREHVDFILLAG
DLFDEANRSLKAQLFLKKQFERLRECGISVYVIFGNHDHLGGEWTPIEWPENVHIFSSAV
PEEKSFFKEGRRIASIYGFSYQARALMENQAARYRRSTDAPFHIGMLHGTLSGSEGHDPY
CPFTHDDLVKSGMDYWALGHIHKRQVLSAEHPAVIYPGNTQARHIKETGDKGYYLVHVTN
GDISYEFQRAHDVLWEKAAVDVTEAKNMTALFQMVEDTFSKLRKKGSPVCVRLVLQGTAP
EWLLEAPKGTLDEFLEALQEQEAEEERFVWPLRLDDETENEANLTNLDPFFGGLFEDIDR
SDLSDVLEGLERHPVYRRHADRFSQEEVKEIKEQAQIILKRQLKVLDT
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgttgactgatctaacctttattcatgcggcagatcttcatcttgacagcccgttttac
gggatatcgcatctgccggagccgatttttgcccggattaaagaaagcacgtttgcaagc
gtgagacatatgatagacgccgcagtgagagagcacgttgatttcattttgcttgcggga
gatctgtttgatgaagccaatcgaagcttaaaggctcagctctttttgaaaaaacagttt
gaaagactcagagagtgcggaatttcggtatacgtcatctttgggaatcacgatcatctt
ggcggggagtggacgccgattgaatggcctgagaatgtccatattttttcgtccgctgtt
ccagaagaaaaatcgttttttaaagaaggcaggcgcatagcaagcatttacggcttcagc
tatcaagccagagcattgatggaaaaccaagccgcccgctatcggagatcaactgacgca
ccgtttcatatcggcatgctccacggcacgctgtcaggatctgaaggacacgatccgtat
tgcccgtttacacatgacgacctcgtgaaaagcgggatggattattgggcgcttggccat
atacataaacgccaggttctatctgccgagcatccggcagtcatttacccgggaaacacg
caagcacgccatataaaggagacgggagataaaggctattatctcgttcatgtgacaaac
ggagatatatcttatgaatttcagagagcgcatgatgtcctgtgggaaaaagcggcggtt
gatgtgacggaggcaaagaatatgacagccctcttccaaatggtggaggacacgttttcg
aagctgcggaaaaaggggagccctgtttgtgtaaggcttgttttacaagggacggcgccg
gaatggctgctggaggcgccaaaaggcaccttggatgagtttcttgaagctcttcaggaa
caagaagcggaagaggaacgtttcgtttggcctcttagattggacgatgagacagaaaac
gaagcaaacctaacaaaccttgatcctttttttggcggtttatttgaagacattgatcgc
agcgatctgtcagacgtgctggaagggcttgagcggcatccagtgtatagaaggcacgcg
gaccggtttagccaagaggaggtaaaggaaataaaagagcaggcacagataatattgaaa
agacagcttaaggtgcttgatacatga

DBGET integrated database retrieval system