KEGG   Bacillus subtilis subsp. subtilis 168: BSU09920
Entry
BSU09920          CDS       T00010                                 

Symbol
yhaN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA_27 AAA_23 AAA_29
Other DBs
NCBI-GeneID: 936294
NCBI-ProteinID: NP_388873
Pasteur: BG12990
BSORF: BG12990
UniProt: O08455 A0A6M4JGL3
Position
1066077..1068968
AA seq 963 aa
MTALRIISLHIYQYGKFSNRTFDFSASPVQVIYGLNEAGKTTMMSFIESMLFGFPKTKKY
EPKTGGVYGGVLEAEHPEYGVLKIERTKGTAEKLSVYTEKGEVKQGDVLKQLFQGTDRSL
YKAIYSFDVFGLQEIHAFNRDKIGEFLLFSSLFGAEAVSKLDSRLTKESERLYKPNGRNP
QLNQELETLKQLAVKLKQAEAEEAGYHQLLEEKRTLEARLAAAETELKETAGHIRMIEGA
IERKPLLNEKATLEQVIAEFPEHAGQFPADGLHQLEKYESHLHPKSAQLEALRVKMAELD
KQRQKLIPDKELLAKETLIQELSAAFHMYQSWGEQLAAIQAQLRQTSAQTAAGLEQLNKT
DENELLNMNTSYDYEWQLQQAVQQYVQARDRKRQLDETFELARQELEDAEKAVRAASSAI
LENSQRKDKEAALRAYDETQGQHQEQAKLREQLTFFERQQAKQKKTVIAAGMLFIVLFSL
LQQWIPAISFGAALIVYWLVSGKSSSRNSRETRQPMTDISPAEAEMLREALWEDDRNKQH
LLTQRAALQQKEAAYERVIQQFEQWEAEMAPSFTQVERFMNELGFKEDPSFLLDAYSLMK
DVKKEVKKKHELTIEAGRLKKHRRTFEERVSMLLPVNQSQDISISDALHTLRKNIEREKE
IEKQKKEIETDIHYTKEQMLELEQEIQYFHAQIEQLFAAAAAKDRDAFFAIAAISRQLKD
TENKLHHVNAQLQGGYPEELELADSNTLSELKDKQFVENERKERLTEEIEQLRSQIALLS
VKQEQLEASGMVSDLKLQTEMQKERVKETAKKWASIQMVKQVIRNKLERHKKIELPRLLE
TAGEFFRPLTDGNYQTIYFSETDDSIMVMHRDGTVYHAEELSQGTCEQLYTAIRFALAVT
RQGESKLPFQLDDSFVHFDQERLKRVLHVLYDLSEGGRQILYFTCHEHVKDAFHSSQIIH
LVS
NT seq 2892 nt   +upstreamnt  +downstreamnt
gtgacagctttgcgaattatatctttacatatctaccaatacggaaaattttccaatcgg
acctttgacttttccgcctctcctgtccaagtcatctacggattaaatgaggcaggaaaa
acgacgatgatgtcattcattgaaagcatgctgttcggttttccgaaaacgaaaaagtat
gaaccgaaaacaggcggtgtctacggcggtgttcttgaagctgaacatcctgagtatggg
gtgctgaagatcgaacggacgaaagggactgccgaaaaactaagcgtgtacacagaaaag
ggcgaagtaaagcagggagatgttttaaagcagctgttccagggcacagacaggtcgttg
tacaaagccatatattcgttcgacgtattcgggctgcaggaaattcacgcctttaatcgg
gacaagataggggaatttttgctcttttccagcttgtttggtgctgaagccgtatcaaag
cttgattcaaggctgacgaaggaaagcgaaaggctctataaaccaaatgggcgaaaccct
caattgaatcaggagctggaaacgcttaagcagctggcagttaagctaaaacaggctgaa
gcagaggaagcgggctatcatcagcttctcgaggaaaaacgaacgcttgaagcccgcctt
gcagccgcggaaaccgaattgaaagagacggcgggacatatccgaatgattgagggagcg
attgagcgaaagccgctgctaaatgaaaaagcgacactcgaacaggtgattgcagaattt
ccggaacacgcaggacaatttcctgctgacggactgcatcagctggaaaaatatgaatcc
catcttcacccgaaatcagcacagcttgaggcgcttcgggtgaagatggcggagttggac
aaacagaggcaaaagcttatccccgataaagaactattggcgaaagaaacgctgatacaa
gagctttcggcagcgtttcatatgtaccaatcctggggagaacagctggcagccattcag
gcacagctgcgccagacgtctgcgcagacagcggcagggctggaacagctcaataaaacg
gatgaaaatgagctcctgaatatgaacacctcatatgattatgaatggcagcttcagcaa
gcggtgcagcaatatgtacaggcaagagacagaaaacggcagcttgacgagacgtttgaa
cttgcccggcaagagctggaagacgcggaaaaggccgttcgtgccgcttcgtccgcgatt
cttgaaaacagccaaagaaaagataaagaagcagctcttagagcatatgatgaaacacag
gggcagcaccaagagcaagcgaagctcagagaacagctaacgttttttgaaagacagcag
gctaaacagaaaaagactgtcattgcagctggtatgttgttcatcgttctcttttctctg
ctgcagcaatggattcccgccataagtttcggcgctgcacttattgtgtattggcttgtt
tcaggaaagtcgtcttctcgaaacagccgagagacaagacagcccatgacggatatttca
ccagcagaagctgaaatgcttagagaagcgttatgggaggatgaccgcaataagcagcac
cttctcacacagcgtgcagcgctccagcaaaaagaggcggcgtatgaaagggtcatccag
cagtttgaacagtgggaagccgaaatggcgccgtcctttacacaggttgagcgttttatg
aatgagctcggatttaaggaagatccatcatttttgcttgatgcatacagcttaatgaag
gatgttaaaaaagaagtgaagaaaaagcatgagctgaccatagaagcaggcaggctgaaa
aagcaccggagaacattcgaagaacgcgtcagtatgcttcttcccgtgaatcagagtcag
gatatctccatttcggacgcccttcacacattgcggaaaaacattgaacgtgaaaaagaa
attgagaagcaaaaaaaggaaattgaaacagatattcattatacaaaggaacagatgctt
gaacttgagcaagaaatacagtatttccacgcacagattgaacagttatttgccgcggct
gctgcaaaagacagagatgcgttttttgccatagccgccatcagcaggcaattgaaggat
acggagaacaagcttcatcacgtaaacgcacagcttcaaggcgggtacccggaggaactt
gaactggcggattccaatacgctttctgaattgaaagataagcaatttgttgagaatgaa
agaaaagagcggctgactgaggagatcgagcagctccgcagccaaatcgcactgctctca
gtcaaacaggaacaattagaggcttcgggaatggtctcagacctcaagcttcaaaccgaa
atgcaaaaagaacgtgtgaaagaaacggctaaaaaatgggcctccatacaaatggtcaaa
caggtgatcagaaacaaattggagcggcataaaaaaatcgagcttccgcgccttctggag
acggcaggagaatttttccgtcctctgactgacggaaactaccaaaccatttatttttcc
gaaacggatgattcgatcatggttatgcatcgcgatggcactgtctatcatgcggaagag
ctgtcacaagggacgtgtgaacagctgtatacagcgatccgctttgctttggccgttacg
cgccagggtgagtcaaagcttccgttccagcttgacgacagttttgttcattttgatcag
gaaaggctgaaacgtgtattacatgttctgtatgatttatctgaaggcggtaggcagatt
ttgtattttacatgccatgagcacgtaaaagatgcatttcatagcagccaaatcatccat
ttggtgtcataa

DBGET integrated database retrieval system