KEGG   Bacillus subtilis subsp. subtilis 168: BSU09930
Entry
BSU09930          CDS       T00010                                 

Symbol
yhaM
Name
(RefSeq) 3'-5' exoribonuclease yhaM
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU09930 (yhaM)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU09930 (yhaM)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BSU09930 (yhaM)
SSDB
Motif
Pfam: HD tRNA_anti-codon
Other DBs
NCBI-GeneID: 939762
NCBI-ProteinID: NP_388874
Pasteur: BG12989
BSORF: BG12989
UniProt: O07521 A0A6M4JH18
Position
1069042..1069986
AA seq 314 aa
MAKGIMLHEVGEQVDQYLLIKSSTKGIASNGKPFLTLMLQDQSGDIEAKLWDAKQSDEVT
YAPQTIVKVVGDVHHYRGRTQLKLRNIRPVSEQENVNIDDFLETAPIPKNEMMDTITQYI
FEMKNPNIQRITRFLVKKHEAEFMDYPAATKNHHEFVSGLAYHVVSMLNLAKAIADLYPS
LDRDLLYAGVILHDLGKVKELSGPVSTSYTVEGNLLGHISIMVTELSKAAEELQIDSEEV
LILQHLILSHHGKAEWGSPKPPMVKEAEILHYIDNLDAKMNMMDRALERVKPGEYTERVF
ALENRSFYKPTFHK
NT seq 945 nt   +upstreamnt  +downstreamnt
atggctaaagggattatgctacatgaggttggcgaacaggtggaccagtatctattgatt
aaatcctcgacgaaagggattgcaagcaatggaaaaccgtttctgacgctgatgctgcaa
gaccagtcaggcgatattgaagcgaagctgtgggatgccaagcaaagtgatgaagtgacc
tatgcgccgcagacgattgtcaaggtcgtcggcgatgttcaccattatcgcggacgcacc
cagctgaagctaagaaatatcagaccggtaagcgagcaagaaaacgtcaatattgatgat
tttttagaaaccgcgccgattccgaaaaatgaaatgatggataccatcactcaatatata
tttgaaatgaaaaatccgaatatccagcgaatcacaaggtttttggttaaaaaacacgaa
gctgagtttatggattatccggcggctacgaaaaaccaccatgagtttgtctcaggtttg
gcgtatcatgttgtctctatgctgaacctggcgaaagcaatagcagatttatatccttct
cttgatcgtgatctgctttacgccggtgttatcctgcatgatcttggaaaagtgaaggag
ctgtccggccctgtttccacttcatatacggttgaaggcaatttgctcggccatatttcc
atcatggtgacagagctttcaaaagcggctgaggagcttcaaatcgattctgaagaggtg
ttaattcttcagcatttgattttgagtcaccacggcaaagcagaatggggcagcccgaaa
ccgcctatggtgaaagaagcggaaattcttcactatatagacaatctggatgcaaaaatg
aatatgatggacagagcgcttgagcgcgtgaagccgggcgagtatactgaacgtgtattt
gcactggaaaaccgttccttttataaaccgacatttcataaataa

DBGET integrated database retrieval system