KEGG   Bacillus subtilis subsp. subtilis 168: BSU09940
Entry
BSU09940          CDS       T00010                                 

Symbol
yhaL
Name
(RefSeq) sporulation protein YhaL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Spore_YhaL TMEM208_SND2
Other DBs
NCBI-GeneID: 936285
NCBI-ProteinID: NP_388875
Pasteur: BG12988
BSORF: BG12988
UniProt: O07520 A0A6M3ZCF9
Position
1070111..1070323
AA seq 70 aa
MLFFPWWVYLCIVGIIFSAYKLVAAAKEEEKVDQAFIEKEGQIYMERMEKERERRSSQQH
EEENQNHSIA
NT seq 213 nt   +upstreamnt  +downstreamnt
gtgttattttttccgtggtgggtgtatctttgtattgtaggcatcattttcagcgcatat
aaacttgtggcggcagccaaagaggaagaaaaagtagaccaggcttttattgaaaaagaa
ggacagatttatatggagaggatggaaaaggagcgagaacgccgcagttctcagcagcat
gaagaagaaaatcaaaaccattccatcgcataa

DBGET integrated database retrieval system