KEGG   Bacillus subtilis subsp. subtilis 168: BSU09950
Entry
BSU09950          CDS       T00010                                 

Symbol
prsA
Name
(RefSeq) foldase protein PrsA
  KO
K07533  foldase protein PrsA [EC:5.2.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU09950 (prsA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     BSU09950 (prsA)
Chaperones and folding catalysts [BR:bsu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    BSU09950 (prsA)
SSDB
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2 SurA_N_2 SurA_N_3 Trigger_C SurA_N DUF1002 RNA_pol_Rpb5_N NifU_N DUF2560 EnY2
Other DBs
NCBI-GeneID: 939294
NCBI-ProteinID: NP_388876
Pasteur: BG10464
BSORF: BG10464
UniProt: P24327 A0A6M4JGI4
Structure
PDB: 
4WO7 1ZK6

Position
complement(1070364..1071242)
AA seq 292 aa
MKKIAIAAITATSILALSACSSGDKEVIAKTDAGDVTKGELYTNMKKTAGASVLTQLVQE
KVLDKKYKVSDKEIDNKLKEYKTQLGDQYTALEKQYGKDYLKEQVKYELLTQKAAKDNIK
VTDADIKEYWEGLKGKIRASHILVADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGG
DLGWFAKEGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTEERGKYDDMKKELKSEV
LEQKLNDNAAVQEAVQKVMKKADIEVKDKDLKDTFNTSSTSNSTSSSSSNSK
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaagaaaatcgcaatagcagctatcactgctacaagcatcctcgctctcagtgcttgc
agcagcggcgacaaagaagttatcgcaaaaacagacgcaggcgatgtcacaaaaggcgag
ctttacacaaacatgaagaaaacagctggcgcaagcgtactgacacagctagtgcaagaa
aaagtattggacaagaagtataaagtttcggataaagaaattgacaacaagctgaaagaa
tacaaaacgcagcttggcgatcaatatactgccctcgaaaagcaatatggcaaagattac
ctgaaagaacaagtaaaatatgaattgctgacacaaaaagcggctaaagataacatcaaa
gtaacagacgccgatatcaaagagtactgggaaggcttaaaaggcaaaatccgtgcaagc
cacatccttgttgctgataaaaagacagctgaagaagtagagaaaaagctgaaaaaaggc
gagaagtttgaagaccttgcgaaagaatactcaacagacagctctgcttcaaaaggcggg
gatcttggctggttcgcaaaagaaggccaaatggacgaaacattcagcaaagctgcattc
aaattaaaaacaggtgaagtcagtgatcctgtcaaaacgcaatacggctaccatatcatt
aaaaagacagaagaacgcggcaaatatgatgatatgaaaaaagaactgaaatctgaagtg
cttgaacaaaaattaaatgacaacgcagctgttcaggaagctgttcaaaaagtcatgaag
aaggctgacatcgaagtaaaagataaagatctgaaagacacatttaatacatcttcaaca
agcaacagcacttcttcatcttcaagcaattctaaataa

DBGET integrated database retrieval system