KEGG   Bacillus subtilis subsp. subtilis 168: BSU09965
Entry
BSU09965          CDS       T00010                                 

Symbol
yhaJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3267 DUF4229
Other DBs
NCBI-GeneID: 936292
NCBI-ProteinID: NP_388878
UniProt: O07518
Position
complement(1072042..1072560)
AA seq 172 aa
MNCWKTINLMKDYGAVRIILTAVCFMILVFISTFLAFELLRPGTSLSDEYVSLFGGLLVV
ILFVHKVIHVLPIICKKRKIEKKFYILRMRTWKRIPKTTMLISLVSPFLLITPVLFYAAL
AFPNHAHYFCMISGIHAGYCLPDFLLALKLIKAPKTAFIDQEADGLDILVEK
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaattgctggaagaccataaatctcatgaaggattatggcgccgttcgcataatatta
actgctgtatgttttatgattttggtttttatatctacctttttagcttttgagctgctg
cggcctggcacaagcttaagcgatgaatatgtatctttattcggcggtttgctcgtcgtt
attttatttgtacataaagtcatccatgtcctgccaatcatctgcaaaaaaagaaaaata
gaaaaaaagttttacatattgcgcatgcgcacatggaaacgtataccaaaaacaacaatg
ctgatttcactcgtcagcccgttcttgctgattacaccggtattgttttacgcagcactg
gcatttccgaatcacgctcattatttttgcatgatctcgggcattcacgccggctactgt
ctgcctgatttcctgctggctctcaagctgataaaagcaccgaaaaccgcttttattgat
caggaagctgacggcttggatattcttgttgaaaagtag

DBGET integrated database retrieval system