KEGG   Bacillus subtilis subsp. subtilis 168: BSU09980
Entry
BSU09980          CDS       T00010                                 

Gene name
yhaI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1878
Other DBs
NCBI-GeneID: 939295
NCBI-ProteinID: NP_388879
Pasteur: BG12985
BSORF: BG12985
UniProt: O07517 A0A6M3ZEB3
Structure
PDB: 
1SED

Position
1072768..1073109
AA seq 113 aa
MDSMDHRIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKEEGEAVMRICDELSEELATQ
KAQGFVTFDKLLALFAGQLNEKLDVHETIFALYEQGLYQELMEVFIDIMKHFD
NT seq 342 nt   +upstreamnt  +downstreamnt
atggattcgatggatcatcgcattgagcgattagaatattacatacaattattagtgaaa
acagtagatatggacaggtaccccttctatgcgcttctcattgataaagggctgagcaag
gaagaaggggaagcggttatgaggatatgcgacgaattgtcggaagagctggcaacacaa
aaagcgcaaggatttgtaacctttgataagctccttgcgctttttgccggacagctgaat
gaaaaattagatgttcatgaaacaatttttgccctgtatgagcaggggctttatcaagag
ctgatggaagtctttatcgacatcatgaagcattttgattaa

DBGET integrated database retrieval system