KEGG   Bacillus subtilis subsp. subtilis 168: BSU09990
Entry
BSU09990          CDS       T00010                                 

Symbol
hpr
Name
(RefSeq) MarR family transcriptional regulator
  KO
K09682  MarR family transcriptional regulator, protease production regulatory protein HPr
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU09990 (hpr)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    BSU09990 (hpr)
SSDB
Motif
Pfam: MarR HTH_27 HTH_34 MarR_2 HTH_IclR
Other DBs
NCBI-GeneID: 939765
NCBI-ProteinID: NP_388880
Pasteur: BG10659
BSORF: BG10659
UniProt: P11065 A0A6M3Z9K4
Structure
PDB: 
2FXA

Position
complement(1073106..1073717)
AA seq 203 aa
MNRVEPPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG
ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEEGTEVFWSLLEE
FDPTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFMEIFETSLTNIDNDFESVNG
KLKKKAKDSAADEPAEELEPVNS
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaatcgagtggaaccgccctatgatgtgaaagaagctctggttttcacccagaaaatg
gctcagcttagcaaggctctttggaaatcgatcgagaaggattggcagcaatggctcaaa
ccgtatgacctgaatattaatgagcatcatattttatggattgcgtatcaattgaatgga
gcttccatttctgaaatcgcgaaattcggggtcatgcacgtatcaaccgcattcaacttt
tcaaaaaagctggaagaacggggatatttaaggttctccaaacggctgaatgataaacgg
aacacatatgtccaattgactgaggaaggtaccgaggtattctggagcttgcttgaggaa
tttgatccgacacgcaacgctgtttttaaagggtcacagcctttatatcatttattcgga
aaatttcctgaagtggcagaaatgatgtgtatgatacgccatatctacggcgatgatttt
atggaaattttcgaaacgtcactcaccaatattgacaatgactttgaaagcgtaaacgga
aaattgaagaaaaaagcaaaggacagtgcggcggatgaaccggctgaagagctcgaacct
gtaaacagttaa

DBGET integrated database retrieval system