KEGG   Bacillus subtilis subsp. subtilis 168: BSU10009
Entry
BSU10009          CDS       T00010                                 

Symbol
yhzF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: STE2
Other DBs
NCBI-GeneID: 8303073
NCBI-ProteinID: YP_003097700
UniProt: C0H3Y3 A0A6M4JEH6
Position
1074381..1074572
AA seq 63 aa
MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTK
LLA
NT seq 192 nt   +upstreamnt  +downstreamnt
ttgtctgtctttttgattgtattatcctgcatcacccttgccttcgcttcaggcgctgtt
tactatatcaaacttctcagccaggctgcttcttatccgcccaagagggttatccggcag
aaagcgcttgtttgttcaaccggaaccgcctttacactatgtcttatctttttcacaaaa
ctcctcgcttaa

DBGET integrated database retrieval system