KEGG   Bacillus subtilis subsp. subtilis 168: BSU10010
Entry
BSU10010          CDS       T00010                                 

Symbol
trpP
Name
(RefSeq) tryptophan transport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TrpP CPP1-like
Other DBs
NCBI-GeneID: 936290
NCBI-ProteinID: NP_388882
Pasteur: BG12983
BSORF: BG12983
UniProt: O07515 A0A6M3Z918
Position
complement(1074646..1075164)
AA seq 172 aa
MKTKELVIMALFAAIGAALHSIIPPFLGGMKPDMMLIMMFMGILLFPRVQNVLVIGIVTG
IISALTTAFPAGQIPNIIDKPVSAFLFFSLFLLFRKSRKTGAAAVLTVIGTILSGIVFLS
SALLIVGLPGGFAALFAAVVLPAAVLNTISMIIIYPIVQTILRRSSFMEAAK
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaaacaaaagagttagtcattatggctctgtttgccgcaatcggcgcagcgcttcat
tccattattccgccctttttaggcggcatgaaaccagatatgatgctgatcatgatgttc
atgggcattctgctgttcccgcgggtgcaaaatgtactcgtcatcgggatcgtgaccgga
atcatttccgcgcttacaaccgcgtttccagccggacagatccctaacatcattgataaa
cccgtatcagcgtttctgttcttctccctgtttctcttgttcagaaagagccggaaaaca
ggtgcagccgctgtgctgacagtgatcgggaccatcttatcaggaattgtgtttctatcg
tcagctttattgatcgtcggtttaccgggcggtttcgccgcattgttcgcggctgttgtt
ctgccggccgctgtgctgaatacaatctcaatgatcattatttatccgattgtgcaaacc
attttaaggcgttcaagctttatggaagctgctaaataa

DBGET integrated database retrieval system