KEGG   Bacillus subtilis subsp. subtilis 168: BSU10020
Entry
BSU10020          CDS       T00010                                 

Symbol
serC
Name
(RefSeq) 3-phosphoserine/phosphohydroxythreonine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu00680  Methane metabolism
bsu00750  Vitamin B6 metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSU10020 (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU10020 (serC)
   00270 Cysteine and methionine metabolism
    BSU10020 (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSU10020 (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU10020 (serC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     BSU10020 (serC)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class V
   BSU10020 (serC)
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-GeneID: 936304
NCBI-ProteinID: NP_388883
Pasteur: BG12673
BSORF: BG12673
UniProt: P80862 A0A6M3Z920
Position
complement(1075289..1076368)
AA seq 359 aa
MERTTNFNAGPAALPLEVLQKAQKEFIDFNESGMSVMELSHRSKEYEAVHQKAKSLLIEL
MGIPEDYDILFLQGGASLQFSMLPMNFLTPEKTAHFVMTGAWSEKALAETKLFGNTSITA
TSETDNYSYIPEVDLTDVKDGAYLHITSNNTIFGTQWQEFPNSPIPLVADMSSDILSRKI
DVSKFDVIYGGAQKNLGPSGVTVVIMKKSWLQNENANVPKILKYSTHVKADSLYNTPPTF
AIYMLSLVLEWLKENGGVEAVEQRNEQKAQVLYSCIDESNGFYKGHARKDSRSRMNVTFT
LRDDELTKTFVQKAKDAKMIGLGGHRSVGGCRASIYNAVSLEDCEKLAAFMKKFQQENE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggaacgtacaacgaattttaacgcaggtcctgcagcgctgccactggaagttctgcaa
aaagcacagaaagaatttattgattttaacgaatccggcatgtctgttatggagctttcc
caccgcagcaaagagtatgaagcggtgcaccaaaaagcgaaaagcctcttaatcgaactg
atgggcattccggaagattacgatatcttgtttcttcaaggcggggcaagccttcaattc
tcaatgcttccgatgaactttttaacacctgaaaaaaccgcacattttgtgatgaccggc
gcttggtctgaaaaagcactggcagaaacgaaactgttcgggaacacgtctatcaccgct
acaagtgaaacagacaattacagttatattccagaggttgaccttacggatgtaaaagac
ggcgcatatttacatatcacatccaacaatacaattttcggcactcagtggcaggagttt
ccgaattctccaattccgctcgtagccgacatgtccagcgatattttaagcagaaaaatc
gatgtgtccaaatttgatgtgatctacggaggcgcccaaaagaacctcggcccttccggc
gtgactgtagtcatcatgaaaaaaagctggctgcaaaatgaaaatgcgaacgtcccaaaa
atcttgaaatattccacgcatgtcaaagcggattcactctacaacactccgccgacattt
gcgatttatatgctgagcctcgttctggaatggctcaaggaaaacggcggtgtggaagct
gttgaacagcgcaatgaacaaaaagcgcaggttctctacagctgtattgatgaaagcaac
ggcttctataaaggacatgccagaaaagacagccgctcacgcatgaatgtcacattcacg
cttcgggatgacgaattaacgaaaacattcgttcagaaagcaaaagatgcgaagatgatc
ggccttggcggacaccgttcggtgggaggctgccgcgcttctatttataacgcggtctct
ctcgaagactgtgaaaaattagctgcgttcatgaagaaattccagcaggaaaatgagtaa

DBGET integrated database retrieval system