KEGG   Bacillus subtilis subsp. subtilis 168: BSU10030Help
Entry
BSU10030          CDS       T00010                                 

Gene name
hinT
Definition
(RefSeq) protein hit
  KO
K02503  histidine triad (HIT) family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU10030 (hinT)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSU10030 (hinT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIT DcpS_C GalP_UDP_tr_C DUF2990
Motif
Other DBs
NCBI-GeneID: 939769
NCBI-ProteinID: NP_388884
Pasteur: BG12607
BSORF: BG12607
UniProt: O07513
Structure
PDB: 

Position
complement(1076515..1076952)
Genome map
AA seq 145 aa AA seqDB search
MHCAENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDEL
AKQYFHAVPKIARAIRDEFEPIGLNTLNNNGEKAGQSVFHYHMHIIPRYGKGDGFGAVWK
THADDYKPEDLQNISSSIAKRLASS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtgcagagaattgtatcttttgtaaaattattgccggcgacattccatcagcg
aaggtgtatgaagatgaacatgtacttgcctttcttgatatcagccaagtgacaaaaggc
catacgcttgtcattccgaaaacacatattgagaatgtatatgaatttacagatgaatta
gcaaaacaatatttccatgctgttccaaaaatcgcccgcgctatccgggatgaatttgaa
ccgatcggcttaaatacgctgaacaataacggcgaaaaagctggacaatctgtgttccac
taccatatgcatattatccctcgctacggaaaaggagatggattcggagcggtttggaaa
acgcatgctgatgattataaaccggaggatctgcagaacatctcttcctctatcgcaaaa
cgcctggcctcatcataa

DBGET integrated database retrieval system