KEGG   Bacillus subtilis subsp. subtilis 168: BSU10040
Entry
BSU10040          CDS       T00010                                 

Symbol
ecsA
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K25158  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10040 (ecsA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU10040 (ecsA)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_30 AAA_23 MeaB MMR_HSR1 Zeta_toxin
Other DBs
NCBI-GeneID: 936293
NCBI-ProteinID: NP_388885
Pasteur: BG11516
BSORF: BG11516
UniProt: P55339 A0A6M3Z927
Position
1077440..1078183
AA seq 247 aa
MSLLSVKDLTGGYTRNPVLKNVSFTLEPNQIVGLIGLNGAGKSTTIRHIIGLMDPHKGSI
ELNGKTFAEDPEGYRSQFTYIPETPVLYEELTLMEHLELTAMAYGLSKETMEKRLPPLLK
EFRMEKRLKWFPAHFSKGMKQKVMIMCAFLAEPALYIIDEPFLGLDPLAINALLERMNEA
KKGGASVLMSTHILATAERYCDSFIILHNGEVRARGTLSELREQFGMKDAALDDLYLELT
KEDAGHE
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtctctgctatcggtaaaagacttgaccggcggatatacaaggaatccggttttaaaa
aacgtatcattcacccttgaaccgaatcaaattgtcggcttaatcgggctgaatggtgct
ggtaaaagtacaacaatcagacacatcatcgggctgatggacccgcataaaggttcaatc
gaattaaacggtaaaacgtttgctgaggatccggaaggctaccgttcacaatttacctat
atacctgaaacacctgttttatacgaagaattgacgctgatggagcatcttgaactaaca
gccatggcatatggactgtcaaaagaaacgatggagaaaaggctgcctccgctactaaag
gaattccgaatggaaaagaggctgaagtggttcccggcccatttttctaaaggaatgaag
cagaaggttatgattatgtgcgcatttttggcagagcctgcgctctacattattgatgag
ccttttctagggcttgatccgcttgccattaacgcgctgcttgaacggatgaatgaagcg
aaaaaaggcggggcgagcgtgctgatgtcaacacacattttggcaacggcagaacgctat
tgcgattcgtttattattttacataacggcgaggtgcgggcgcgcggcacgctgtcagag
ctcagagagcagtttggaatgaaggacgcggcgctggacgatttgtatcttgagcttaca
aaggaagacgctggccatgaataa

DBGET integrated database retrieval system