KEGG   Bacillus subtilis subsp. subtilis 168: BSU10050
Entry
BSU10050          CDS       T00010                                 

Symbol
ecsB
Name
(RefSeq) ABC transporter permease EcsB
  KO
K25157  ABC-2 type transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10050 (ecsB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU10050 (ecsB)
SSDB
Motif
Pfam: EcsB
Other DBs
NCBI-GeneID: 939298
NCBI-ProteinID: NP_388886
Pasteur: BG11517
BSORF: BG11517
UniProt: P55340 A0A6M3ZCH4
Position
1078176..1079402
AA seq 408 aa
MNNMLDIWQSRLQEHIKETRTYMKYMLNDHLVIVLIFFLAGAASWYSKWIRDIPAHFPSF
WVMAVLFSLVLTSSYVRTLLKEADLVFLLPLEAKMEPYLKQAFVYSYVSQLFPLIALSIV
AMPLYFAVTPGASLVSYAAVFVQLLLLKAWNQVMEWRTTFQNDRSMKRMDVIIRFAANTL
VLYFVFQSVYMYALLVYVIMAVLYLYMSSAAKRKTFKWESHIESELRRKQRFYRIANLFT
DVPHLRKQAKRRAYLDFLLRLVPFEQRKTFAYMFTRAFLRSSDYLGILVRLTIVFALIIM
YVSASPLIAAVLTVFAIFITGIQLLPLFGHFDHLALQELYPVQKETKLKSYFSLLKTALS
IQALLMSVASAYAAGLTGFLYALIGSAVLIFVVLPAYMTTRLKKHGKL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaataatatgcttgatatttggcagtcgcggctgcaggagcatatcaaagaaacaaga
acatacatgaaatatatgctcaacgatcacctcgtcattgttttgattttttttctagcg
ggcgctgcaagctggtacagcaaatggatacgggacattcccgctcactttccgtccttt
tgggtgatggccgtgctgttttcgctcgtattgacaagctcttatgtgcgaacgcttttg
aaggaggctgaccttgttttcttattgcctcttgaagcaaaaatggagccttacttgaag
caggcgtttgtctacagctatgtgtctcagctgtttccgctgattgcgctgagcatcgtt
gcgatgccgctttatttcgcagtcactccgggagcttcgctcgtatcgtatgccgcggtc
tttgtccaactgttgctgctgaaagcgtggaatcaggtaatggaatggcgaacgactttc
caaaacgaccgcagcatgaaacggatggacgtcatcattcgctttgcggcgaatacactc
gttctttattttgttttccaatctgtttatatgtatgcgcttctcgtctatgtcattatg
gctgttctttatctgtatatgtcttccgcagcaaaacggaaaacatttaaatgggagagc
catattgagtccgaattgagacgaaagcagcgtttctatcggattgccaacctgtttact
gatgtgccgcatttgcgaaagcaagccaaacgcagagcttatctcgactttttgctgcgg
cttgtgccgtttgaacagcgcaaaacatttgcctatatgttcacccgcgcctttttgcgt
tcgagcgattatttgggcattcttgtcagattaacgatcgttttcgcgctgatcattatg
tatgtctcagccagcccgctgattgccgcggttttgactgtgtttgccattttcattacg
ggcattcagcttctgccgctcttcggtcactttgaccatctggcgcttcaagagctgtac
cctgtgcaaaaagaaacaaagctgaaaagctatttctctctattaaaaactgcacttagt
attcaagcgctgctgatgtctgttgcatctgcctatgcagccggcttgaccggttttctg
tacgcgctgatcggttctgccgttctgatttttgttgttttgcctgcttatatgacgacc
aggctgaaaaagcacggaaagctgtga

DBGET integrated database retrieval system