KEGG   Bacillus subtilis subsp. subtilis 168: BSU10060
Entry
BSU10060          CDS       T00010                                 

Symbol
ecsC
Name
(RefSeq) ABC transporter substrate-binding protein EcsC
  KO
K25159  protein EcsC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10060 (ecsC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU10060 (ecsC)
SSDB
Motif
Pfam: EcsC DUF5581
Other DBs
NCBI-GeneID: 939774
NCBI-ProteinID: NP_388887
Pasteur: BG11518
BSORF: BG11518
UniProt: P55341
Position
1079422..1080132
AA seq 236 aa
MTDNQLLMQEALEWKMHFLRKDSMFERFSKRVQTKVNERIPEKIHTVVTESVKKMVEATM
AGSNIITYKKDTSALSLSEKNELAKKTIVSYQKVAAAEGVGTGAGGIFLSIADFPLLLSI
KMKCLFTLSSIYGFDVKDAQERIFLLLVFQLAFSSDDGRKSLFSVIENWETEKKSIDWRV
FQQEYRDYIDVVKLFQLLPGVGAAVGGIANYKLLAQLGETARHVFHLRILKETAGE
NT seq 711 nt   +upstreamnt  +downstreamnt
atgacagataatcagctgctgatgcaggaagctttggaatggaaaatgcattttttgcga
aaggattccatgtttgaacgcttttcgaagcgtgtccagacgaaggtgaatgaacggatt
cctgaaaaaatccatacggtcgtcaccgagagtgtgaaaaaaatggtagaagcgacaatg
gccggctctaatatcatcacctataaaaaggatacaagtgcactgtcgctcagtgaaaaa
aacgaattggcgaaaaaaacgattgtttcttatcaaaaagtggcagctgctgagggagtc
ggcaccggagcgggcggcatttttttaagcattgctgattttccgctgctgctttcaatt
aagatgaagtgtttatttaccttgtcttccatttacggctttgatgtcaaggatgcacaa
gaaaggatatttttgctgctcgtgtttcagcttgcgttttcgagtgatgatggccgtaag
tcgcttttttctgtcatcgaaaattgggagacggagaaaaagagcatcgactggagagtg
ttccagcaggaatatcgcgattatatcgacgtcgtgaagctttttcagcttttgccgggc
gtaggagcggcagtcggcggaattgccaattataagctgcttgctcagcttggagaaacg
gcaagacatgtttttcatctgaggatattaaaggaaacagccggagaataa

DBGET integrated database retrieval system