KEGG   Bacillus subtilis subsp. subtilis 168: BSU10070
Entry
BSU10070          CDS       T00010                                 

Symbol
yhaA
Name
(RefSeq) amidohydrolase YhaA
  KO
K01436  amidohydrolase [EC:3.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU10070 (yhaA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BSU10070 (yhaA)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M20
   BSU10070 (yhaA)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer
Other DBs
NCBI-GeneID: 936299
NCBI-ProteinID: NP_388888
Pasteur: BG12982
BSORF: BG12982
UniProt: O07598 A0A6M3Z9F9
Position
complement(1080150..1081340)
AA seq 396 aa
MSISTLQKEINKQLDGCFEEMVEIRRHFHMYPELSFQEEKTAAFIASYYESLGVPIRTNV
GGRGVLANIEGSEPGPTVALRADFDALPIQDEKDVPYASKVPGVMHACGHDGHTAALLAV
AKVLHQNRHELKGTFVMIHQHAEEYYPGGAKPMIDDGCLENTDVIFGTHLWATEPLGTIL
CRPGAVMAAADRFTIKVFGKGGHGAHPHDTKDAVLIGSQIVSSLQHIVSRKVNPIQSAVI
STGSFIADNPFNVIADQAVLIGTARSFDENVRDILEKEIEAVVKGICSMHGASYEYTYEQ
GYPAVVNHPAETNHLVSTAKNTEGVQQVIDGEPQMGGEDFAYYLQNVKGTFFFTGAAPEQ
PERVYSHHHPKFDINEKAMLTAAKVLAGAAITYHQL
NT seq 1191 nt   +upstreamnt  +downstreamnt
ttgtccatatccacactgcagaaagagataaacaaacagctcgacggctgttttgaagaa
atggttgagatcaggcgccattttcatatgtatcctgagctctcatttcaagaagaaaaa
accgccgcatttattgcttcctattatgaatcgttaggagtcccaatccgcacaaacgtt
ggcggtagaggggttttagcaaatatagaaggaagcgaacccggccctacagtcgctttg
agggccgactttgacgctctccccattcaagatgaaaaagatgtcccttacgcctccaaa
gtgcctggtgtcatgcatgcatgcggccacgacggccacaccgcagctcttctcgcagtg
gccaaggtccttcaccaaaacagacatgaactgaagggaacatttgtgatgatccaccag
catgcagaagaatattatcctggaggcgcaaagccaatgattgatgacggatgtctcgaa
aacacggatgtgatattcggcactcatctttgggcaactgagccgctcggaactattctc
tgccgccccggcgccgtaatggcggcggcagaccgatttacgattaaagtcttcggaaag
ggcggccacggcgctcatccgcatgatactaaagacgccgtcctaatcggttcgcaaatc
gtttcctctttgcagcacattgtcagccgcaaagtcaatccgattcaatccgccgtcatt
tcgacaggctccttcatcgccgacaatccgtttaatgtcatcgcagaccaagcagtactc
atcggcacagcgcgttcttttgatgaaaatgtccgggacattctggagaaagaaattgaa
gcggttgtaaaaggaatatgcagcatgcacggcgcgtcctatgagtacacctatgaacag
ggttatccagcggttgtgaaccatcctgcagaaacgaaccacttggtgagcaccgcaaag
aataccgagggcgttcagcaggtcattgacggtgaaccacaaatgggcggcgaggatttt
gcttattacttacaaaacgtgaagggcacttttttctttacaggcgccgctcccgaacag
ccagagcgagtctattcccaccaccatccgaaatttgatatcaacgaaaaagccatgctg
acagcggccaaggtccttgccggcgctgcgatcacctatcatcagctataa

DBGET integrated database retrieval system