KEGG   Bacillus subtilis subsp. subtilis 168: BSU10080
Entry
BSU10080          CDS       T00010                                 

Symbol
yhfA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CitMHS B12D DUF2649
Other DBs
NCBI-GeneID: 939301
NCBI-ProteinID: NP_388889
Pasteur: BG13047
BSORF: BG13047
UniProt: O07599 A0A6M3ZEC5
Position
complement(1081413..1082804)
AA seq 463 aa
MMEVGILPVHVLYVFFIGAIILFMLLRKDTTFISLFGIFIISLWASHSLSASVSSLFHSF
IYAAGELLPTIFIICFIVSMSDLLTKTGINEAMISPFASLVRGPVTAYWLIGGLMFAISL
FFWPSPGVALIGAVLLPAAARAGLTPLAAAMAMNLFGHGFALSGDFVIQAAPKLTADAAG
IPVGDVVSASIPLVLIMGVTTTTAAFIMIQRERKKQEHPTSFSPVLSGEQDNSLYLPKRL
RSILAFLIPLAFLADIACMLLFNLQGNDATALIGGSAICILFTVHFFVYKHKGLEKITGY
FIDGFKFGFKVFGPVIPIAAFFYLGDSGYESILGTSLPKGSHGIVNDLGIALSHMMPMSK
ELAATALTAAGAITGLDGSGFSGISLAGSIAKLFSSALHADPAILTALGQISAIWVGGGT
LVPWALIPAAAICKVDPFELARKNFIPVAIGLLVTTLAAVMML
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgatggaagtcgggattttgcctgtccatgttctgtatgtgttttttatcggtgcaatt
atcctatttatgctgctgagaaaagacacgacatttatttctctattcggcatttttatc
atatcgctatgggccagccattcactttcagcttctgtcagcagtttattccacagcttt
atctatgcggccggcgaactgctgcccacgattttcatcatttgctttatcgtttcaatg
agtgatttgttaacaaaaacagggataaatgaagcgatgatttctccctttgcaagcctt
gtgagagggcctgtgactgcctattggctgattggaggcctgatgttcgccatttctcta
ttcttctggccttctccgggtgtcgctttgatcggcgccgtcctgctccccgcagccgca
cgtgccggtttgacgcctcttgccgcggccatggccatgaacttattcggacacggtttt
gccctgtcaggagactttgtcattcaggcggcgccaaagctgactgcggatgcagcaggc
attccagtcggtgatgtcgtctcggccagtattccgcttgtgctgattatgggtgtgaca
acaacaactgctgcctttatcatgattcagcgcgaacgcaaaaaacaggagcatcccact
tctttttcccccgttctttccggcgaacaagacaactcgctgtacttgccaaaacgcctg
cggtccatactggcttttttgattccgcttgcctttcttgcagatatcgcctgcatgctc
ttgtttaacctacaaggaaatgatgcaaccgcgttaattggcgggtctgcaatttgtatc
ctctttaccgttcattttttcgtgtataagcataaagggcttgaaaaaatcaccggctat
tttattgacggatttaagttcggttttaaggttttcggccccgtcatcccgattgccgct
ttcttttatcttggcgactcaggctatgaaagcatactgggcacttcactccctaaaggt
tcccacggcattgtcaacgatcttggcattgctttatcccatatgatgcctatgtcaaag
gagcttgccgccactgcattaactgccgctggagccataacaggccttgacggctcagga
ttttctggcatttctctcgccggctccatcgcaaagctcttttcgtccgctctccatgcc
gatcccgctattctgaccgcgctcggacaaatctctgccatctgggtgggcggaggaaca
ctggtcccatgggctttgattcccgccgcggccatttgcaaagttgatccttttgagctt
gccagaaaaaacttcattcccgtcgcgattggccttttggtgacaaccctcgcagctgtg
atgatgctttaa

DBGET integrated database retrieval system