KEGG   Bacillus subtilis subsp. subtilis 168: BSU10090
Entry
BSU10090          CDS       T00010                                 

Symbol
yhgB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936298
NCBI-ProteinID: NP_388890
Pasteur: BG10426
BSORF: BG10426
UniProt: P38048 A0A6M3Z9L4
Position
complement(1082870..1083184)
AA seq 104 aa
MKHTCPVCGFKDWLNRHMIMKAIILMKSARAAVFSSDLMSTRCSTRITHIEPSESIIAYR
KNWLAEGCVIFSPECFPKHLQKANRGLRHHLIEQLKQINVHLPS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaagcatacttgcccagtctgcgggtttaaggattggctgaaccgccatatgatcatg
aaggcaatcattctcatgaaatctgcccgtgctgcggttttcagttcggatttgatgagt
acgagatgcagcacgaggataactcatatagagccatcggaaagcatcatcgcctataga
aaaaactggcttgctgaagggtgcgtcattttttctcctgaatgcttcccaaaacatctg
caaaaagcgaatagaggattaaggcatcatctgattgagcagctgaaacagatcaatgtt
catcttccatcataa

DBGET integrated database retrieval system