KEGG   Bacillus subtilis subsp. subtilis 168: BSU10100
Entry
BSU10100          CDS       T00010                                 

Symbol
yhgC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ABM DUF5730 DUF1961
Other DBs
NCBI-GeneID: 939297
NCBI-ProteinID: NP_388891
Pasteur: BG10427
BSORF: BG10427
UniProt: P38049 A0A6M3Z9I7
Structure
Position
complement(1083229..1083729)
AA seq 166 aa
MKVYITYGTADFLKTIVQKHPSENILLMQGQENAILIHETNGDTVFQAPHAYEVIDQVGE
IKHPGFAVLNNIAVTQEGRPLFENRFKNRAGKVENEPGFEAIRVLRPLDSDTYVILTLWE
TESAFQDWQQSGSYKEAHKKRDTSAGIDTTSIFSRPSYVTTYFAVE
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaggtttatattacatatgggacagccgattttttaaaaacgatcgtacagaagcat
ccctcagaaaatatccttttgatgcaggggcaggaaaacgccattttaattcatgaaaca
aacggagataccgttttccaggcaccacacgcttatgaagtcattgaccaagtcggagag
atcaaacatcccggttttgcagtattgaacaatattgccgttactcaggaagggcgtccg
ctgtttgaaaacagatttaaaaacagagcgggaaaagtcgaaaacgagcctggctttgaa
gcaattcgagtgctccgtccgcttgacagtgacacctatgtcattctgaccttgtgggaa
acggaaagcgcctttcaagactggcagcagtccggttcttacaaagaagcccacaaaaaa
cgcgatacatctgccggaattgacacaacgtcgatcttctcccggccttcctatgtcacc
acatatttcgctgtcgaatag

DBGET integrated database retrieval system