KEGG   Bacillus subtilis subsp. subtilis 168: BSU10100Help
Entry
BSU10100          CDS       T00010                                 

Gene name
yhgC
Definition
(RefSeq) hypothetical protein
  KO
K21481  heme oxygenase (mycobilin-producing) [EC:1.14.99.57]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU10100 (yhgC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.57  heme oxygenase (mycobilin-producing)
     BSU10100 (yhgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABM
Motif
Other DBs
NCBI-GeneID: 939297
NCBI-ProteinID: NP_388891
Pasteur: BG10427
BSORF: BG10427
UniProt: P38049
Structure
PDB: 

Position
complement(1083229..1083729)
Genome map
AA seq 166 aa AA seqDB search
MKVYITYGTADFLKTIVQKHPSENILLMQGQENAILIHETNGDTVFQAPHAYEVIDQVGE
IKHPGFAVLNNIAVTQEGRPLFENRFKNRAGKVENEPGFEAIRVLRPLDSDTYVILTLWE
TESAFQDWQQSGSYKEAHKKRDTSAGIDTTSIFSRPSYVTTYFAVE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttatattacatatgggacagccgattttttaaaaacgatcgtacagaagcat
ccctcagaaaatatccttttgatgcaggggcaggaaaacgccattttaattcatgaaaca
aacggagataccgttttccaggcaccacacgcttatgaagtcattgaccaagtcggagag
atcaaacatcccggttttgcagtattgaacaatattgccgttactcaggaagggcgtccg
ctgtttgaaaacagatttaaaaacagagcgggaaaagtcgaaaacgagcctggctttgaa
gcaattcgagtgctccgtccgcttgacagtgacacctatgtcattctgaccttgtgggaa
acggaaagcgcctttcaagactggcagcagtccggttcttacaaagaagcccacaaaaaa
cgcgatacatctgccggaattgacacaacgtcgatcttctcccggccttcctatgtcacc
acatatttcgctgtcgaatag

DBGET integrated database retrieval system