KEGG   Bacillus subtilis subsp. subtilis 168: BSU10110
Entry
BSU10110          CDS       T00010                                 

Symbol
pbpF
Name
(RefSeq) penicillin-binding protein 1F
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
bsu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU10110 (pbpF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU10110 (pbpF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU10110 (pbpF)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU10110 (pbpF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BSU10110 (pbpF)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSU10110 (pbpF)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   BSU10110 (pbpF)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BSU10110 (pbpF)
SSDB
Motif
Pfam: Transgly Transpeptidase SMP_2 MutS_I Sigma_reg_N
Other DBs
NCBI-GeneID: 939766
NCBI-ProteinID: NP_388892
Pasteur: BG10428
BSORF: BG10428
UniProt: P38050 A0A6M3Z979
Position
1083851..1085995
AA seq 714 aa
MFKIKKKKLFIPIIILVLTAFLALIGYISIIFLGHYVIDEKKLILHASSKIVDQNGDEVA
SLYTENREPVSINEIPKQVREAFIAVEDKRFYEHHGIDAKSVGRAVYRDILAGGKVEGGS
TITQQLAKNIFLTHDKTFLRKTKEVIIAINLERDYSKDKLLEMYLNQLYFGHGVYGIQAA
SHYYFNKEVKDLTVSEGAVLAAIPKAPSTYSPILHPDKNKERRDTILGMMNDQGYISAKE
AVTAQGRTLGLHVKKQSETPWFDSYIDLVIKEAEDKYSISGEQLLQGGYTIKVPLDSKLQ
KTAYQVMKEGSYYPGTDQNAEGSAVFINNKTGGVEAAIGGRDYTSKGYNRVTAVRQPGST
FKPLAVYGPAMQEKKFKPYSLLKDELQSYGDYTPKNYDSRYEGEVTMSDAITYSKNAPAV
WTLNEIGVETGKSYLKANGIDIPDEGLALALGGLEKGVSPLQLAGAFHTFAANGTYTEPF
FISSIIDEDGETIADHKEEGKRVFSKQTSWNMTRMLQQVVKKGTATSGTYHGDLAGKTGS
TSYTGVSGATKDAWFAGYTPKITGAVWMGYDKTDQNHYLKAGSSYPTRLFKDILTQAGET
GHVFTKPKNVKELESPIELKPVKTLTADYTFKAAGLFTIELKWDAQEDDRAVYRIYVNKD
GEETLLDSVEGKGSYEIPYANLFSGASYKIVPYNTQTKREGEGTDYVQPKLFSS
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgtttaagataaagaaaaagaaactttttatacctatcattattttagtgttaactgct
tttctcgctttaataggatatatttcaattatttttctcggccattatgtcatagatgaa
aaaaagcttattcttcatgcttcttcaaaaattgttgatcaaaacggagatgaggttgca
agcctgtatacagaaaatcgcgagccggtctcgatcaatgagattcctaagcaggtcaga
gaagcgtttatcgctgttgaggataaaaggttctatgagcatcacggcattgatgcaaaa
tccgtcggaagggcagtgtaccgcgatatattagcaggcggaaaggtggaaggcggaagc
acgatcacccagcagcttgccaaaaatatttttctgacacatgacaaaacatttctaaga
aaaacaaaagaagtgatcattgcgattaatcttgaacgggattacagcaaggacaagctg
cttgaaatgtatttaaaccagctttacttcggacacggggtttacggcatacaagcggcg
tcccactattattttaataaagaagtaaaagatttgactgtatctgaaggcgctgttttg
gccgctattccgaaggcgccttctacgtactctccaattttgcaccctgataaaaataag
gagcggcgtgatacaattctaggtatgatgaatgaccaaggctatatcagtgcgaaagag
gctgtcaccgcacagggccggacgcttggactgcatgtgaagaaacagtcggaaacacct
tggtttgacagctacattgaccttgtgatcaaagaggcggaagacaagtattccatttcc
ggagagcagcttcttcaaggcggatacacgatcaaggtgccgctcgattcgaagctgcag
aagacggcttaccaggtgatgaaagagggaagctattatcccggaacagatcagaatgcc
gagggaagcgcggtctttattaataacaagacaggcggtgtagaagcggccatcggcgga
agggattacacatccaaaggatataaccgtgtcacagctgtccgccagccgggttccaca
tttaagccgcttgctgtatacggaccggcgatgcaggaaaagaaatttaagccatattct
ctattgaaggatgagttgcagtcctacggagattatacgccgaaaaactacgacagccgg
tatgagggcgaagtcactatgtctgacgccattacgtacagcaaaaacgcgccggctgtc
tggacgctgaatgagatcggcgtcgaaacagggaaatcttatttgaaagcaaacggcatt
gatatccctgatgaaggccttgctcttgctctaggcggcttggaaaaaggcgtttcaccg
ctccagcttgccggcgcgtttcatacatttgccgcgaatggaacgtatactgaacccttc
tttatctcgagcataatagatgaagacggagaaacaatagccgatcataaagaagaagga
aagcgggtattcagcaagcagacgtcttggaatatgacgagaatgctgcagcaggtagtc
aaaaagggaacggccacgtccggcacctatcacggcgacctggcgggaaaaacaggttca
acatcttatacaggcgtctccggcgcgacaaaggacgcctggtttgcaggctatacgccg
aaaataaccggggcagtctggatgggctatgacaaaacggatcaaaaccattatttgaaa
gccgggagctcatacccgacgcggctgtttaaggatattttgacacaggcaggagaaacc
ggtcatgtgttcacaaagcctaaaaacgttaaagaactggaaagcccgattgagctgaag
ccggtcaaaacactcacagccgattacacatttaaagcagcggggctctttactattgaa
ttaaagtgggacgctcaagaggatgatcgggccgtatacagaatttatgtaaacaaggac
ggcgaggagacgcttcttgattcggttgaagggaagggaagctatgaaattccttatgcc
aacttattttcgggcgcgtcttataaaattgtgccttataatacacagacaaaaagagaa
ggggaaggaaccgattacgttcagccaaaattgttttcctcttaa

DBGET integrated database retrieval system