KEGG   Bacillus subtilis subsp. subtilis 168: BSU10120
Entry
BSU10120          CDS       T00010                                 

Symbol
hemE
Name
(RefSeq) uroporphyrinogen decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    BSU10120 (hemE)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     BSU10120 (hemE)
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-GeneID: 936296
NCBI-ProteinID: NP_388893
Pasteur: BG10429
BSORF: BG10429
UniProt: P32395 A0A6M3Z936
Structure
PDB: 
2INF

Position
1086117..1087178
AA seq 353 aa
MSKRETFNETFLKAARGEKADHTPVWYMRQAGRSQPEYRKLKEKYGLFEITHQPELCAYV
TRLPVEQYGVDAAILYKDIMTPLPSIGVDVEIKNGIGPVIDQPIRSLADIEKLGQIDPEQ
DVPYVLETIKLLVNEQLNVPLIGFSGAPFTLASYMIEGGPSKNYNKTKAFMYSMPDAWNL
LMSKLADMIIVYVKAQIEAGAKAIQIFDSWVGALNQADYRTYIKPVMNRIFSELAKENVP
LIMFGVGASHLAGDWHDLPLDVVGLDWRLGIDEARSKGITKTVQGNLDPSILLAPWEVIE
QKTKEILDQGMESDGFIFNLGHGVFPDVSPEVLKKLTAFVHEYSQNKKMGQYS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgagtaaacgagaaacgtttaacgagacgtttttaaaagctgcgcggggagaaaaagcg
gatcacacgcctgtgtggtatatgaggcaagcagggcgctcacagccggaataccgcaag
ctgaaggaaaagtacggattgtttgagatcacacatcagcccgaactttgtgcgtatgtc
acaagactgccggttgagcaatacggagtcgatgctgcaatcctttataaagatatcatg
acgccgctgccgtcaatcggtgtggatgttgaaatcaaaaacgggatcggtcctgtgatt
gatcagccaatccggtctctggcggacattgaaaaactcggccagattgatccggaacag
gacgtgccgtacgtgcttgagacgattaaactgcttgtcaatgagcagctgaacgtcccg
ctcatcggtttctcaggtgcgccttttacgcttgcaagctatatgatcgaaggcggcccg
tcgaaaaactacaataaaacaaaagccttcatgtacagcatgccagatgcatggaatctg
ctgatgtccaagcttgccgacatgatcatcgtgtacgtgaaagcgcagattgaggcaggc
gcaaaagcgattcaaatctttgattcgtgggtcggcgcattgaatcaggcagattacaga
acatacatcaaacccgtgatgaaccggatcttttcagagctcgcaaaggagaatgtgccg
ctgatcatgtttggcgttggcgcaagccatcttgcaggtgattggcatgaccttcctctc
gatgttgtcgggcttgactggagactcggcattgatgaagccagatcaaaaggaattact
aaaacagtgcagggcaacctggacccgtccattttgcttgcgccatgggaagtcattgag
cagaaaacgaaggaaatacttgatcagggtatggagtcagacggcttcattttcaatctt
ggccatggggtatttcctgatgtcagtcccgaggttttgaaaaaactgacagcatttgtc
catgaatattcacaaaacaaaaaaatgggtcaatattcctaa

DBGET integrated database retrieval system