KEGG   Bacillus subtilis subsp. subtilis 168: BSU10130
Entry
BSU10130          CDS       T00010                                 

Symbol
hemH
Name
(RefSeq) ferrochelatase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU10130 (hemH)
Enzymes [BR:bsu01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     BSU10130 (hemH)
    4.99.1.9  coproporphyrin ferrochelatase
     BSU10130 (hemH)
SSDB
Motif
Pfam: Ferrochelatase Ribosomal_L3
Other DBs
NCBI-GeneID: 939772
NCBI-ProteinID: NP_388894
Pasteur: BG10430
BSORF: BG10430
UniProt: P32396 A0A6M3Z933
Structure
PDB: 

Position
1087250..1088182
AA seq 310 aa
MSRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQIT
EQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTF
SVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIV
SAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTR
DLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDAL
ATVVLKKLGR
NT seq 933 nt   +upstreamnt  +downstreamnt
gtgagtagaaagaaaatggggcttctcgtgatggcgtacggcacgccttataaggaagaa
gatattgaacgttattatacacatatcagaagaggcagaaagcctgaacctgaaatgctt
caagatttgaaagacagatacgaagcgattggcggcatttcaccgcttgcccaaatcaca
gaacagcaggcgcataatctggaacagcacttgaatgaaattcaggatgagattacgttt
aaagcgtatatcggactgaagcatatcgagccgtttattgaagacgccgtagcagagatg
cataaggatggcattacagaagcagtcagcatcgtgctggcgccgcatttctccacgttc
agcgttcagtcctacaacaaacgcgccaaagaagaggctgaaaaactcggcggcttaacg
attacgtcagttgaaagctggtacgatgaaccgaagttcgtgacatattgggttgaccga
gtgaaggaaacatatgcgtcaatgcctgaggatgaaagagaaaacgcaatgctcatcgta
tccgcacacagcctgccggaaaaaatcaaagaatttggagacccgtacccggaccagctt
catgaatcggcgaaattaattgctgaaggcgcaggcgtttccgaatatgctgtcggctgg
caaagtgaagggaacacgcctgatccttggctcggacccgatgttcaggatttaacacgt
gatttattcgaacaaaaaggctatcaagcatttgtatatgttcctgttgggtttgtcgcg
gatcacttagaagtgctttatgataatgattatgaatgcaaagtggttactgacgatatc
ggcgcaagctattaccggccggaaatgccaaatgccaagcctgaatttattgatgctttg
gcaacagtcgtattaaaaaaattaggacgttaa

DBGET integrated database retrieval system